KEGG   Burkholderia ambifaria AMMD: Bamb_2469Help
Entry
Bamb_2469         CDS       T00398                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bamb_2469
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bamb_2469
   00680 Methane metabolism
    Bamb_2469
Enzymes [BR:bam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Bamb_2469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:2720489..2723485
Genome map
AA seq 998 aa AA seqDB search
MKSSGSARTTRRNAALPSSDAQTGTIATAANGRAKTATKPKDPIPRTKRTIKASGPAART
AKPGVRTREDKDGPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDDSEA
AQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTVAYA
LEQLKTTGNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTA
RERSYNESMLRARVTALWQTRMLRDSRLTVGDEIENALSYYRATFLDELPALYGDIEAAL
AEHGLPARVPAFLQMGSWIGGDRDGNPNVTGPTLDEAINRQAAVILEHYLEQVHKLGAEL
SVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVPVRS
AGRGAPPVRAIPYADSEAFVADLKVLTASLEEHHGASLAAPRLTPLVRAAEVFGFHLASI
DLRQSSDIHEAVVAELFARAGVEADYAALAEEDKLRVLLAALADPRPLRSPYLEYSALAQ
SELGVFEKAREVRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGPLGSHAKNGL
MVIPLFETIPDLRDAARIMREYFALPGIDALIAHQGAEQEVMLGYSDSNKDGGFLTSNWE
LYRAELALVDVFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEV
IASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQTLSDAAMASYRALVY
ETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAIPWGFSWGQCRLLLT
GWYGFGSAVSAYLDGAPDEAERTKRLTLLKKMNKTWPFFANLLSNMDMVLAKTDLAVASR
YAQLVADRKLRKHVFERIVAEWERTSQALAEITGHEGRLATNPLLARSIKNRFPYLDPLN
HLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacgacgcgccgcaatgctgccctgccctcctccgat
gcccagacgggtaccatcgctaccgccgcgaacggccgtgcgaaaacggcaacgaaaccg
aaagacccgatacctcggacaaaacgcacgatcaaggcttccggcccggccgcccgcacc
gcgaagcccggcgtgcgcacgcgcgaggacaaggacggcccgctgttcgaggacatccgc
ttcctcggccgcctgctcggcgacgtggtgcgcgaacaggaaggcgacaccgtgttcgac
gtcgtcgaaacgatccgccagaccgcggtgaagttccgtcgcgaagacgacagcgaagcc
gcgcagactttggaaaagaagctgcgcaagctgaccccggagcagacggtgagcgtcgtg
cgcgcgttcagctatttctcgcacctcgcgaacatcgcggaagaccgccaccacaaccgc
cgccgccgcatccacgcgctggccggctccgcgccgcagccgggcaccgtcgcgtacgcg
ctcgaacagctgaagacgaccggcaacgcgtcgaagcgcctgctgcagcgcttcttcgac
gatgcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtgcagcgcaagagcatc
ctcgacgcgcagcacgacatcgcgcggctgctcgccgagcgcgaccagccgctcaccgcg
cgcgaacgctcgtacaacgaatcgatgctgcgcgcgcgcgtgaccgcgctgtggcagacc
cgcatgctgcgcgactcgcgcctgacggtcggcgacgagatcgagaacgcgctgtcgtac
taccgcgcgacgttcctcgacgagctgcccgcgctgtacggcgacatcgaagccgcgctc
gccgagcacggcctgcctgcgcgcgtgcccgcgttcttgcagatgggcagctggatcggc
ggcgatcgcgacggcaacccgaacgtcaccggcccgacgctcgacgaagcgatcaaccgc
caggccgcggtgatcctcgaacattatctggaacaggtgcacaagctcggcgccgagctg
tcggtgtccaatctgctggtcggcgcgaacgacgcggtgaaggcgctcgcggccgcctcc
cccgaccagtcgccgcaccgcgtcgacgaaccgtatcgccgtgcgctgatcggcatctac
acgcggctcgccgccagcgcgcgcgtgcgccttggcgaaggcacggtgccggtgcgcagc
gcgggccgcggcgcgccgccggtgcgcgcgattccgtatgcggattccgaagcgttcgtc
gccgacctgaaggtgctgaccgcgtcgctcgaagaacaccacggcgcgtcgctcgccgcg
ccgcgcctgactccgctggtgcgcgcggccgaagtgttcggcttccatctcgcgagcatc
gacctgcgccagagctccgacatccacgaagccgtggttgccgagctgttcgcgcgtgcc
ggcgtcgaagccgactacgcggcgctcgccgaggaagacaagctgcgcgtgctgctggcc
gcgctcgccgatccgcgcccgctgcgctcgccgtacctcgaatactcggcgctcgcgcag
agcgagctcggcgtgttcgagaaggcccgcgaggtgcgcgcgcagttcggcgcgcgtgcg
gtgcgcaactacatcatctcgcatacggaaaccgtcagcgacctcgtcgaggtgctgctg
ctgcagaaggaaacggggctgctcgaaggcccgctcggcagccatgcgaagaacggcctg
atggtgatcccgctgttcgagacgatccccgacctgcgcgacgccgcgcggatcatgcgc
gagtacttcgcgctgccgggcatcgacgcgctgatcgcgcatcagggcgccgagcaggag
gtgatgctcggctactcggacagcaacaaggacggcggcttcctgacgtcgaactgggag
ctgtatcgcgccgaactcgcgctcgtcgacgtgttccgcgaacgcaagatcacgctgcgg
ctgttccacggccgcggcggcacggtcggccgcgggggcggcccgacctaccaggcgatc
ctgtcgcagccgccgggtaccgtgaacggccagatccgcctgaccgaacagggcgaggtg
atcgcgagcaagttcgcgaaccccgaaatcggccggcgcaacctcgagacggtagtcgcc
gcgacgctcgaggcgtcgctgctgccgcagtcgaacgcgcccgcgcaactgcccgcgttc
gaagccgcgatgcagacgctgtcggacgccgcgatggcgtcgtatcgcgcgctcgtctat
gaaacgcccggcttcaccgactacttcttctcgtcgacgccgatcaccgagatcgcggag
ctgaacatcggcagccgcccggcctcgcgcaagctgcaggatccgaagaaccgcaagatc
gaggatctccgcgcgattccgtggggcttctcgtggggtcagtgccggctgctgctgacg
ggctggtacggcttcggcagcgcggtgagcgcgtatctcgacggcgcgccggacgaggcc
gaacgcaccaagcgcctgacgctgctcaagaagatgaacaagacctggccgttcttcgcg
aacctgctgtcgaacatggacatggtgctcgcgaagaccgatctcgcggtcgcgtcgcgc
tatgcgcagctggtcgccgaccgcaagctgcgcaagcacgtgttcgagcggatcgtcgcg
gaatgggagcgcacgtcgcaggcgctcgcggaaatcaccgggcacgaaggccgcctcgcg
accaacccgctgctcgcacgctcgatcaagaaccgcttcccgtatctcgatccgctgaac
cacctgcaggtcgagctgatcaagcgtcaccgcgcgggcgacacgaacgcgcggctgcgc
cgggggattcacctgaccatcaacgggatcgcggccggcctgcgcaacacgggctga

DBGET integrated database retrieval system