KEGG   Burkholderia ambifaria AMMD: Bamb_6150Help
Entry
Bamb_6150         CDS       T00398                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
bam  Burkholderia ambifaria AMMD
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:complement(711088..712872)
Genome map
AA seq 594 aa AA seqDB search
MTKCASTIHRLIESLEDVDGATHRMAFVDDAGNEAGITYRRFAEAVFREAGALRELGVHE
NDMVMLALPASVEHAVAMMACVMIGALPCTVPVPARRATAGRQVVDVACERYRPRVVVAA
DAQAAAWHDAAFPAASTRVVDFATLSMAADSGARALISAKHGRDPHHIQLTSGSTSHPKA
AVLSHENVIANVLGIGGSVRFDIAAGDGTASWLPLYHDMGLLTLLSNLHYRAPLLMMQPN
SFIRNPLGWLKRIASARATTTSVPTFALRYCVRRFNAAAMDGVDLSACRNIFIGGERVDE
ATLRDFAATFAPYGLAASALQPCYGMAESTLAVSMHRAWHEGAVDGAPYVIADTIGRRAL
IEQRAAQPVTHDDNRDPHAETETVLAMGTPIEGMAFCILDDGDHPLAARTVGEVAIRGTS
VMLGYLNPDDGAIAAPLTADGWFRTGDIGYVADGQLHILGRKKEVIIIRGSNYFPHEIEE
ALAAHRALRKSTCIAFGLPDPQTGTERLVVAIEARPADATPQTRTECQQLLASRIGFAAQ
DLCFVEPGSLPRTTSGKLQRLKCRDLYATGALPVIAAPGETAAAGADARQGAYA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaagtgcgcatccaccattcatcgcctgatcgagtcgctcgaggacgtcgacggt
gcgacgcaccgcatggcgttcgtcgacgatgcgggcaacgaagccggcatcacgtaccgg
cgtttcgcggaagcggtgttccgcgaggccggcgcactgcgcgaactcggcgtgcacgag
aacgacatggtgatgctcgcgctgccggcgtccgtcgagcatgcggtcgcgatgatggcc
tgcgtgatgatcggcgcattgccgtgcaccgtgccggttcccgcccgacgcgccacggcc
gggcgtcaggtggtcgacgtcgcgtgcgagcgatatcgtccgcgcgtcgtcgtcgccgcg
gatgcacaggccgccgcgtggcacgacgctgcgtttccggccgcgtcgacgcgcgtggtc
gatttcgcgacgctgtcgatggccgcggacagcggcgcacgcgcgctgatcagcgcgaag
catggccgcgatccgcatcatattcagttgacgtccggctcgacgtcgcatccgaaagcg
gccgtgctcagccacgagaacgtgatcgcgaacgtgctcggaatcggcgggtcggtgcgc
ttcgacatcgcggccggcgacggcaccgcgtcgtggctgccgctctatcacgacatgggg
ctgctgacgctgctgtcgaacctgcactaccgcgcgccgctattgatgatgcagccgaac
agcttcatccggaacccgctcggctggctcaagcgcatcgcgtcggcgcgcgcgaccacg
acgtcggtgccgaccttcgcgctgcgctactgcgtgcgccgcttcaacgcggccgcgatg
gacggcgtcgacctgtccgcgtgccgcaacatcttcatcggcggcgaacgcgtggacgaa
gccacgctgcgcgatttcgccgcgacgttcgcgccttatggcctcgccgcatcggcgctg
cagccgtgctacgggatggccgaatcgacgctcgcggtatcgatgcaccgcgcgtggcat
gaaggcgcggtcgacggtgcgccgtacgtgatcgccgacacgatcggccggcgcgcgctg
atcgagcaacgcgcggctcaaccagttacgcatgacgacaaccgcgacccgcacgcggaa
actgaaaccgtgctcgcgatgggcacgccgatcgaaggcatggcgttctgtatcctcgac
gacggcgaccatccgctcgcggcacgcacggtcggcgaagtcgcgattcgcggcacatcg
gtgatgctcggctacctgaacccggacgacggcgcgatcgccgcgccgctgaccgccgac
ggctggttccgcaccggcgacatcggttacgtcgccgacggtcagctgcatattctcggg
cgcaagaaggaagtcatcatcattcgcggcagcaactacttcccgcacgagatcgaggaa
gcgctggccgcgcatcgggcactgcgcaagagcacctgcatcgccttcgggctgcccgat
ccgcagacgggcaccgaacgcctggtcgtcgcgatcgaggcacggccggccgacgccacg
ccgcagacgcgcaccgaatgccagcagctgctcgcatcgcggatcggcttcgccgcacag
gatctgtgcttcgtcgaacccggctcgctgccgcgcacgacgagcggcaagctccagcgg
ctgaagtgtcgcgatctgtatgcgaccggcgcgctgcccgtgatcgccgcgccgggcgag
acggcggccgccggcgccgacgcccggcaaggagcgtacgcatga

DBGET integrated database retrieval system