KEGG   Bacillus velezensis UCMB5033: RBAU_0464Help
Entry
RBAU_0464         CDS       T02795                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama00473  D-Alanine metabolism
bama00550  Peptidoglycan biosynthesis
bama01100  Metabolic pathways
bama01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bama00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RBAU_0464 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RBAU_0464 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RBAU_0464 (ddl)
Enzymes [BR:bama01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RBAU_0464 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bama01011]
 Precursor biosynthesis
  Amino acid ligase
   RBAU_0464 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: CDG28439
UniProt: S6FH49
LinkDB All DBs
Position
513237..514322
Genome map
AA seq 361 aa AA seqDB search
MKTSLGLVYGGKSAEHNVSLQTALAVTKALNTEKFDIHPIYITEKGEWQRGPLLTEPVSN
VKMLQLEQNGENFALSALNREMFPEASTDEKAPIDVVFPLLHGPNGEDGTIQGLLELLNV
PYVGNGVLASSAGMDKVIMKHLFAQAGLPQAKYAAFLKKDWKQTPDSCLQQVEEELGYPC
FVKPANLGSSVGISKCRNREELEKAFELAFEYDRKIVVEEGIAGREIEIGVLGNDEPKCS
AVGEIAPKTDFYDYKAKYEDGDTDLMIPAQVTDEQYAEISEMAIKAFKAIDGSGLVRADF
FLTNDGQVLINEVNTMPGFTPFSMFPLLWKEAGVEYSDLIEQLVELAKERHAEKQLIKHT
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaagtctaggattggtgtacggcggaaagtcagccgaacacaatgtatcgctg
cagacagcattagctgtaacaaaagcgcttaatactgagaagtttgatatacatccgatt
tacatcactgaaaaaggagaatggcaaagaggcccgctgctgactgagccggtttccaac
gtgaaaatgcttcagctggaacaaaacggtgaaaatttcgctctatcagcattgaaccgg
gaaatgtttcctgaagcgtcgactgacgaaaaggcgccgatcgatgtcgtatttccgctt
ctgcacggaccgaacggtgaagacggcaccattcagggtctgctggaattgctgaacgtt
ccttatgtcggcaacggcgtgcttgcatcatcagccggcatggataaagtcatcatgaag
catttgttcgctcaagcggggcttccgcaggcgaagtacgccgctttcttaaaaaaggac
tggaaacagacgccggacagctgcttacagcaggttgaagaggagctgggatatccgtgc
ttcgtcaaaccggcgaacctcggatcaagcgtcggaatcagcaaatgccgaaaccgtgaa
gagcttgaaaaagccttcgaactggcttttgagtatgaccggaaaattgtggtggaagaa
ggaatcgccggaagagaaattgaaatcggcgtactcggaaatgacgaaccgaaatgctcc
gccgtcggtgaaatcgcgccgaaaaccgacttttacgattacaaagcgaaatatgaagac
ggcgacacggatttaatgattcccgcgcaagtgacggatgaacaatatgcggaaatcagc
gagatggcgattaaagccttcaaagcgattgacggatcaggccttgtccgcgccgatttc
ttcctgaccaatgacggtcaagtgctcattaacgaagtgaacacaatgccgggctttacg
ccattcagcatgttcccgctgctttggaaagaagcaggcgtagagtacagtgatctgatc
gaacagctggttgagctggcaaaagaacgccatgccgaaaaacagctgattaaacataca
ttttaa

DBGET integrated database retrieval system