KEGG   Bartonella ancashensis: PU02_1228Help
Entry
PU02_1228         CDS       T04086                                 

Definition
(GenBank) Superoxide dismutase (Fe)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
banc  Bartonella ancashensis
Brite
Enzymes [BR:banc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PU02_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1338246..1338848)
Genome map
AA seq 200 aa AA seqDB search
MAFELIELPYNYDALAPYMSRETLEYHHDKHYLTYLINANNFIKDLKLEEKCLEDLVVES
FNTHVGLFNNISQYYNHTHFWKWMKKDGGGSKIPEKLMKSLESSFGSYDKFRADFIVAGT
SQFGSGWAWLAVQDGELKIMKTPNGENPLIHGAQPILGVDVWEHSYYIDYRNARPKYLEA
FVDHLINWDYVLELYENCKF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattaattgaattaccttataattatgatgctcttgcaccttatatgtcg
cgtgaaacgcttgagtatcatcatgataagcactacctaacgtatcttatcaatgccaat
aattttataaaagatttaaagctagaagagaaatgtcttgaagatcttgtagtagaaagc
ttcaatactcatgttggtttgtttaataatatatcgcagtattataaccatactcacttt
tggaaatggatgaagaaagatggtggtggtagcaaaattcctgagaaattaatgaagtct
ttggaaagtagttttggtagttatgataagtttcgtgcagattttattgttgcgggtaca
tctcaattcggttctggttgggcatggcttgctgttcaggatggtgagctgaagattatg
aaaacacctaatggtgaaaaccctcttatccacggagctcagccgattttaggtgttgat
gtgtgggagcattcttattacattgactatcgcaatgcgcgtccaaaatatttggaagct
tttgtagatcatctgatcaactgggattatgttttggagctatatgaaaattgcaaattc
tag

DBGET integrated database retrieval system