KEGG   Bifidobacterium angulatum: BBAG_1543Help
Entry
BBAG_1543         CDS       T03930                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bang  Bifidobacterium angulatum
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bang00001]
   00620 Pyruvate metabolism
    BBAG_1543
  Energy metabolism
   00680 Methane metabolism
    BBAG_1543
Enzymes [BR:bang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBAG_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1968287..1971034
Genome map
AA seq 915 aa AA seqDB search
MAKDEQQIVPADASIVETGTGRKAPEEHDLPENLKYDMDLCLKILRDVLNEYDPKLLTTF
DTVRKYAVEASDEHFGGNTNTDEDGLAEAVKIIDEMNLHDAQLLARAFATHFHLANLSEE
NYRVSVLRERESEVDDINAVDPVNELTVAYHKLINEMGPAKAKELLDRLEFHPVFTAHPT
EARRKAVEGKIRRISELLEQHNKLGGSDKKENSRRLYNEIDALFRTSPIALKKPTPVEEA
DTILDIFDSTLFHTIPQVYRRFDDWLLGDKAGLEPPVCPAFFHPGSWIGSDRDGNPNVTA
KVSRQVARKFSDHVVSALEEATRTVGRNLTMEAGTTPASTELKDLWNHQKEMSERLTEKA
ALISSKELHRAVMLVMADRLHYTVVRDADLMYHSCEDFIADLKTVQRSLAAAGAKRSAYG
PLQDLIWQAETFGFHMVEMEFRQHSVVHSRALEDIREHGLHGERGELQPMTHEVLDTFRA
LGSIQKRNGMKAARRYIISFTKSAQNIKDVYELNRLAFAHPEDVPTIDVIPLFEQLEDLQ
NSVNVLEEMIKIPEVQARLKATGGKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKWAE
SHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPTLAIR
HVESVAAATLLQSAPSVEKRNTDMTEKYADMASKLDEAAHERFLDLLNTDGFAPWFSTVT
PLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGDLD
TLRKAYEEWPLFSTFIDNIEMSIAKTDERIARMYLALDDREDLPEKVLTEMKLTRKWVLA
IVGDKWPLQHRHVLGRAVRIRSPYVDVLSLTQVLALKSLRKKVDKEELSHGKREGYTYLI
LCTVSGVAAGLQNTG
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaagatgaacagcaaatcgtgcctgccgacgcttccatcgtggaaaccggcacc
ggccgcaaggctccggaagagcacgatcttcctgagaatctgaaatacgatatggatctg
tgtctgaagatccttcgtgatgtgctcaatgagtacgatcccaagctgctcaccactttc
gacaccgtgcgcaaatatgcggtcgaagcaagcgacgagcatttcggcggcaacacaaac
acggacgaggacggtctggccgaggccgtgaagatcatcgacgagatgaatctgcacgat
gcccagctgcttgcccgcgcattcgccacccacttccacctcgccaatctttccgaggag
aactaccgcgtttccgtgctgcgtgaacgcgagtccgaagtggacgacatcaacgccgtg
gatccggtcaacgagctcaccgtcgcctaccataagctcatcaacgagatgggcccggcc
aaggccaaggagctgctggaccgcctggagttccacccggtgttcaccgcgcacccgacc
gaggcacgccgcaaggccgtggaaggcaagatccgcaggatctccgaactgctcgaacag
cacaacaagcttggcggctccgacaagaaggagaacagccgtcgcctgtacaacgagatc
gacgcgctgttccgcacctccccgatcgcgctgaagaagccgacccccgtcgaggaagcc
gacaccattcttgacattttcgattccacgctgttccacaccatcccgcaggtgtaccgc
cgtttcgacgactggctgctgggcgacaaggccggcctggaaccgccagtgtgcccggca
ttcttccacccgggaagctggatcggctccgaccgcgacggcaacccgaacgtcaccgcc
aaggtgagccgtcaggtggctcgcaagttcagcgatcatgtggtctccgcccttgaagag
gcgacccgcaccgtgggcaggaacctgacgatggaagccggcaccacgccggccagcacc
gagctcaaggacctgtggaaccatcagaaggaaatgagcgaacgcctgaccgaaaaggcc
gccctgatctccagcaaggaactgcaccgcgcggtcatgctggtcatggccgaccgcctg
cattacacggtcgtgcgcgacgccgatctgatgtaccactcctgcgaggatttcatcgcc
gatctgaagaccgtgcagcgttccctcgccgcggcaggcgccaagcgttccgcctatggc
ccgctgcaggacctgatctggcaggccgaaaccttcggcttccacatggtcgagatggag
ttccgtcagcactccgtggtgcattcccgcgcgctggaggatatccgcgagcatggtctg
catggcgaacgcggcgaactgcagccgatgacccacgaggtgctcgacaccttccgcgca
ctcggctccatccagaagcgcaacggcatgaaggccgcccgccgttacatcatctccttc
accaagagcgcccagaacatcaaggacgtgtacgagctgaaccgtctggcgttcgcccac
ccggaggacgtgccgaccatcgacgtgatcccgctgttcgaacagctggaggatctgcag
aactcggtgaacgtgcttgaggaaatgatcaagattcctgaagtgcaggctcgtctgaag
gcgaccggcggcaagctggaagtcatgctcggctactccgattcctcgaaggacgccggc
ccgacctccgccacgctggccctgcactccgcgcaggagcgcattgccaagtgggcggaa
tcacacgacattgacctgaccctgttccatggccgcggcggtgccgtaggtcgtggcggc
ggccccgccaaccgcgcggtgctcgctcagccggtcggttccgtgaaatgccgtttcaag
ctcaccgagcagggcgaggtcattttcgcccgctacggcaacccgaccctggccatccgc
cacgtcgagtccgttgcggccgcgacgctgctgcagtccgctccgagcgtggagaaacgc
aacacggatatgaccgagaagtacgccgacatggccagcaagctcgacgaagccgcccat
gagcgcttcctcgacctgctgaacaccgacggtttcgccccgtggttctccaccgtgacg
ccgctgaccgagatcggcttgctgccgatcggctcccgcccggcgaagcgtggcctcggc
gccaagtccctcgacgatctgcgtaccatcccgtggatcttctcctgggcccaggcccgc
atcaacctggccgcatggtacggcctgggcaccgcctgcgagaagttcggtgatctggac
acgctgcgcaaggcgtacgaggagtggccgctgttctcgacgttcatcgacaacatcgaa
atgtcgattgccaagaccgatgagcgtatcgcccgcatgtacctcgccctcgacgaccgc
gaggatctgccggaaaaggtgctcaccgagatgaagctgacccgcaagtgggtgctcgcc
atcgtcggcgacaagtggccgctgcagcaccgtcacgtgcttggccgcgccgtgcgcatc
cgttccccgtacgtggacgtgctctcgctcacccaggtgctggcgctcaagtcgctgcgc
aagaaggtggacaaggaagagctcagccacggcaagagggaggggtacacgtacctcatc
ctgtgcaccgtttcgggtgtcgccgcaggcctgcagaacacgggctga

DBGET integrated database retrieval system