KEGG   Bifidobacterium animalis subsp. lactis ATCC 27673: BLAC_00295Help
Entry
BLAC_00295        CDS       T02862                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
banl  Bifidobacterium animalis subsp. lactis ATCC 27673
Pathway
banl00620  Pyruvate metabolism
banl00680  Methane metabolism
banl01100  Metabolic pathways
banl01120  Microbial metabolism in diverse environments
banl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:banl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLAC_00295
  Energy metabolism
   00680 Methane metabolism
    BLAC_00295
Enzymes [BR:banl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BLAC_00295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGW84287
LinkDB All DBs
Position
complement(63523..66279)
Genome map
AA seq 918 aa AA seqDB search
MTDQEQTITPADATIVSSGLGTKGPEERTLPATLQEDMDLCLNILRQVLSEYDENLLKTF
DTVRQYAVDASAERFSGVLTDTHPERDDLEMAVKTIDAMNLHDAQLLARAFATYFHLANL
CEENYRVAVLHEREAKVDDTQAIDPVNEMTKAYHQLISEMGPAKAKELLERLEFHPVFTA
HPTEARRKAVEGKIRRIAQLLEAHRLLGGSDKKEDSRRLYSEIDALFRTSPIALKKPTPV
EEADTILDIFDNTLFHTIPMVYRRFDDWMLGDKAGIEPPACPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLAALEEATRTVGRNMTVESETTPPSDELRALWNQQKEISERLT
GKASLISTKELHRAVLLVMADRLHYTIKRDTDLMYHNCDDFLADLRVVQRSLAEAGDKRA
AYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALDDIREHGLHGERGPLQPMTHEVLDT
FRALGAIQKRNGVKAARRYIISFTKSAKNVRDVYELNRLAFSNPDDAPVIDVIPLFEQLE
DLEHSVSVLDEMLKIPEVQARLKQTGRKMEVMLGYSDSSKDAGPTTATLALHSAQERIAK
WADENDIDLTLFHGRGGAVGRGGGPANRAVLAQPKGSVKCRFKLTEQGEVIFARYGNPVL
AIRHVESVAAATLLQSAPSVEKTNTEMTEKYKPMANQLSEVSHETFLDLLNSEDFAPWFS
IVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGSACESFG
DLATLRKAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDRPDLSKKVLDEMELTRKW
VLKIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVLALRSLRKKVDKEELSESQQAGFI
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcaagagcaaacgatcacgccggccgacgccacgatcgtgtcgtccgggctc
ggcaccaaaggtcccgaagagcgcacgcttcccgcgacattgcaggaagacatggacttg
tgtctgaacattctgcgccaggtgctttccgaatacgacgagaatcttctcaaaacgttt
gacaccgtgcgtcagtatgccgtcgatgccagtgccgagcggttctccggcgtgctcacc
gacacgcatcccgaacgagacgacctagagatggccgtcaagacgatcgatgcgatgaat
ctgcacgatgctcagctgctcgcccgcgcgttcgccacgtacttccacctggcgaatctg
tgcgaggagaactaccgtgtggccgtgctccatgagcgcgaggccaaggtcgacgacacc
caggccatcgatccggtgaacgagatgacgaaggcctaccaccagctcatctccgaaatg
ggtccggccaaggccaaggagctgctcgaacgcctcgaattccacccggtgttcactgca
caccccaccgaggcgcgccgcaaggccgtggaaggcaagatccgccgcatcgcacagctg
ctcgaagcgcaccgtctgctcggcggctccgacaagaaggaggacagccgtcgcctgtac
agcgagatcgacgcactgttccgcacgtcgccgattgcgctgaagaagccgacgcctgtc
gaagaggccgacacgattctcgacatcttcgacaacacgctgttccacacgattccgatg
gtctaccgtcgtttcgacgactggatgctcggcgacaaggcaggcatcgagccgccggca
tgccccgcgttcttccacccgggcagctggatcggttccgaccgcgacggcaacccgaac
gtcaccgccaaggtgagccgtcaggtggcccgcaagttcagcgaccatgtgctcgccgcg
ctcgaggaggccacgcgcaccgtcggccgcaacatgaccgtcgaatccgagaccacgcca
ccgagcgacgaactgcgcgcgctgtggaaccagcagaaggagatcagcgagcgactcacc
ggcaaggcatcgctcatctccacgaaggagctgcatcgcgcggtgctgctcgtcatggcc
gaccgcctgcattacacgatcaagcgcgacaccgatctcatgtaccacaactgcgacgac
ttcctcgcggatcttcgcgtggtgcagcgttcgctcgccgaggccggcgacaagcgcgcc
gcctatggcccgctgcaggacctcatctggcagaccgagaccttcggcttccacatggtc
gaaatggagttccgccagcattcggtggtgcatgcgcgcgccctcgacgacattcgcgag
cacggcctgcatggcgaacgcggaccgttgcagccgatgacgcatgaggtgctcgacacc
ttccgtgccctcggcgcgatccagaagcgcaatggcgtcaaggccgcgcgccgctacatc
atctcgttcacgaagagcgcgaagaacgtgcgcgacgtgtacgagctcaaccgtctggcg
ttctcgaatccggacgacgccccggtgatcgacgtgatcccgctgttcgaacagctcgag
gatctcgagcattcggtctcggtgctcgacgagatgctgaagattcccgaggtgcaggcc
cgactcaagcagaccggccgcaagatggaggtcatgctcggctactcggattcgtcgaag
gatgccggccccaccaccgccacgctcgcgctgcactccgcgcaggagcgcattgcgaag
tgggcggacgagaacgacatcgatctgacgctgttccacggccgcggcggcgccgtcggt
cgtggcggtggcccggccaaccgcgcggtgctcgcacagccgaagggttcggtcaagtgc
cgcttcaagctcaccgagcagggcgaggtcatcttcgcccgctacggcaatccggtgctc
gccatccgccacgtcgagtccgtggccgccgcgacgctgttgcagtcggctccgagcgtg
gagaagacgaacaccgagatgaccgagaagtacaagccaatggcgaatcagctcagcgaa
gtttcacatgaaacgttccttgatctgctcaacagcgaggacttcgcgccatggttctcg
atcgtcacgccgttgaccgagatcggcttgctgccgatcggttcccgccctgcgaagcgc
ggcttgggagccaagtcgctcgacgatctgcgtacgatcccgtggatcttctcgtgggcc
caggcccgcatcaacctcgccgcctggtatggcctcggctccgcatgcgagtcgttcggc
gacctcgccacgctgcgcaaggcatacgaggaatggccgctgttctccacgttcatcgac
aacatcgagatgtcgctggcgaagaccgacgaacgcatcgcgaagatgtaccttgcactc
ggcgaccgcccggacctctcgaagaaggtgctcgacgagatggaactcacacgcaagtgg
gtgctcaagatcgtcggcgacgaatggccgctgcagcaccgtcatgtgcttggccaggcg
attcgcatccgctccccgtacgtcgacgcactgtccgtcacgcaggtgctcgcattgcgt
tcgctgcgtaagaaggtcgacaaggaggagctctccgaaagccagcaggcaggattcatc
tacctgatcctctgcaccgtttcgggtgtcgccgccggcctgcagaacaccggctga

DBGET integrated database retrieval system