KEGG   Bacillus anthracis Ames Ancestor: GBAA_2079Help
Entry
GBAA_2079         CDS       T00178                                 

Gene name
dal2
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    GBAA_2079 (dal2)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    GBAA_2079 (dal2)
Enzymes [BR:bar01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GBAA_2079 (dal2)
Peptidoglycan biosynthesis and degradation proteins [BR:bar01011]
 Precursor biosynthesis
  Racemase
   GBAA_2079 (dal2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1946892..1948067
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKANGYGHGAVEVAKAAIEAG
INQLAIAFVDEAIELREAGINVPILILGYTSVAAAEEAIQYDVMMTVYRSEDLQGINEIA
NRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVVGMFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIHIPYIHSSNSAGSMEPSNTFQNMVRVGIGIYGMYPSKEVNH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
HALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENNETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacat
aatgtaaaagaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgta
aaagcgaatgggtatggtcatggggcagttgaagttgcaaaagctgctattgaagcagga
ataaatcagcttgcaattgcatttgtagatgaagcgatagagttaagagaagcaggaatt
aacgtgccgattttaattttaggctatacatcagtagcggctgcggaagaagcaattcaa
tatgacgttatgatgaccgtttatagaagtgaagatttacaaggtataaatgaaatcgca
aaccgtcttcaaaagaaagcgcaaattcaggtgaaaattgatacaggaatgagtcgcatt
ggtttacaggaagaagaggttaaaccatttttagaggaattaaaacgtatggagtatgta
gaggtagtgggaatgtttacacattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgagaaagctgtcaatacagcaaaagaattaggaattcat
attccatatattcatagttcaaatagtgcaggttcaatggaacctagcaatacatttcaa
aatatggttcgtgtaggtatcggaatttatggaatgtatccttcaaaagaggtaaatcat
tcagttgtttcgttacagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcat
gcgaagaaaaatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatgg
attgccaccgtaccgattggttatgctgatggttataatcgtcagttgtctaataaaggg
catgcattaataaatggagttcgagtacctgttattggccgtgtttgtatggatcagctc
atgttagacgtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggt
aaacaaggcgaagaaaacatcgcagtagaagaaatagcggatatgttaggtacaattaac
tatgaagttacatgtatgttagatagaagaattccacgtgtgtataaagaaaataatgaa
acaactgctgttgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system