KEGG   Bathyarchaeota archaeon BA2: AOA66_1651Help
Entry
AOA66_1651        CDS       T04066                                 

Gene name
for
Definition
(GenBank) Tungsten-containing formaldehyde ferredoxin oxidoreductase
  KO
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
barb  Bathyarchaeota archaeon BA2
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:barb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AOA66_1651 (for)
Enzymes [BR:barb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     AOA66_1651 (for)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 610 aa AA seqDB search
MHGWNGKLLRVDLTKGKAVSQEYDASFAKTFLGGRGFAAKILWDELKPGIDPLSPENKLI
FAAGPLTALPLPSSGKLLVAAKSPLTGGYGDGNLGTHATVQMRRAGYDAIVIQGKASKPT
TLYIHDAKTEFVDAKDYWGEGSLQTEKALKKEHGTSVGVIAIGQAGENQVKFANAVSQGG
RAGGRPGMGAVMGSKNLKAVVVRGTKTLPVKDAKAVKTLGLEAYREVLAKPNYDFWKRQG
TMSVVEWSQENSVLPTQNFREGVFDEADEIGGFAMEKIKISNRGCPHCNMTCGNVVEDSE
KLPSELDYENVALLGSNIGLGNLKEVATLNRLADDYGVDTISLGNVIGFAMEASEKRLVD
YRVEWGDFEEAKVLAEDVVYKRGIGALLAEGVRSASKKVGGDAEKLAMQIKGLEVSGYNC
HTTPGMALSYGTCSIGAHHKDAWVISWEVSVGRESYGEAKVDKVIELQRLRGGVFECLTT
CRLPWVEVGFGLYWYPKFLKAATGVDMTMNDLFTIADRTFALMRAFWVREYADSWSRNMD
VPPARWFDEPLTKGHFKGATLDREKYDSMLGVYYGKRGWDNRGIPTESSLARLGLRDVAE
ELGRYVKLSV
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcacggttggaacggcaaactactgcgagtagacctaacaaaaggaaaggctgtttct
caagaatatgatgccagcttcgccaagaccttccttggcggaagaggctttgcagctaaa
attctctgggacgaactgaaaccagggatagacccgctttctcctgaaaacaagctaatc
ttcgcagccggaccactaacggcccttccgcttcccagcagcggcaaactcctagtcgcg
gcgaaaagtcccttaacaggtggttacggcgacggaaacctaggcacccacgcaacggtt
caaatgagaagggctggatacgacgccatcgtcatacaagggaaagcttcgaaacccacc
accctgtatattcacgatgccaaaacagagttcgttgacgccaaagactactggggcgaa
ggctcccttcaaaccgaaaaagccctcaaaaaagagcatggtacaagcgtaggtgtcatc
gccataggtcaagctggagaaaaccaagttaagttcgccaatgcggtttctcaaggaggc
cgggcgggcggtagacctggcatgggcgcagttatgggctctaaaaacctgaaggcagta
gttgttagaggaacaaaaaccctgccagtaaaggatgctaaagccgtaaaaaccttaggt
cttgaagcctaccgggaagtattggcaaaaccaaactacgatttttggaagcgtcaggga
actatgtcggtcgtagaatggagccaagaaaacagtgttcttccaacgcaaaactttcgg
gaaggagttttcgacgaagcagatgaaatcggaggttttgctatggagaaaataaaaatt
tccaacagaggttgtcctcactgcaacatgacttgtggcaatgtggtggaggattctgag
aagttgccttctgaactggactacgaaaatgttgctctgctggggtctaacataggtcta
ggcaatctcaaagaagtagcaactttgaacaggcttgccgacgactatggagtagacact
atatctcttggaaacgttataggtttcgctatggaggcttcagaaaagaggctcgtcgac
tatagggttgaatggggagactttgaagaagcgaaggtcctagctgaagatgtagtctat
aaacgtggaataggcgctcttcttgcggaaggtgtacggtcagcgtctaagaaggtgggc
ggtgatgctgaaaagttggctatgcagataaagggcttggaagtttcaggttacaactgt
catacaactcctggaatggcgctgtcttatggcacttgctccattggtgctcatcacaag
gatgcttgggttatttcttgggaggtttcggttggacgtgaaagctatggcgaagctaaa
gttgacaaggttattgagttgcagaggttgaggggaggagtgtttgagtgtctgacgact
tgtcgccttccgtgggtggaggtgggctttgggttatattggtatcccaagtttctgaag
gctgcaactggcgtggacatgaccatgaatgatttgttcaccattgctgacagaactttt
gctttgatgagagctttttgggtaagggagtacgctgatagttggagtaggaacatggat
gttccgccggcgagatggtttgatgaacctcttacaaaaggtcacttcaagggagcaact
ttagatagagaaaaatacgacagtatgcttggggtgtactatggcaagaggggctgggat
aatcggggaatacccactgagagttcgttagctaggctgggtttgcgagatgttgctgag
gaacttggtaggtatgtgaagttgtcggtttga

DBGET integrated database retrieval system