KEGG   Bathyarchaeota archaeon BA1: AOA65_0957Help
Entry
AOA65_0957        CDS       T04065                                 

Gene name
lig_2
Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
barc  Bathyarchaeota archaeon BA1
Pathway
barc03030  DNA replication
barc03410  Base excision repair
barc03420  Nucleotide excision repair
barc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:barc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AOA65_0957 (lig_2)
   03410 Base excision repair
    AOA65_0957 (lig_2)
   03420 Nucleotide excision repair
    AOA65_0957 (lig_2)
   03430 Mismatch repair
    AOA65_0957 (lig_2)
Enzymes [BR:barc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AOA65_0957 (lig_2)
    6.5.1.6  DNA ligase (ATP or NAD+)
     AOA65_0957 (lig_2)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AOA65_0957 (lig_2)
DNA replication proteins [BR:barc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AOA65_0957 (lig_2)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AOA65_0957 (lig_2)
DNA repair and recombination proteins [BR:barc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AOA65_0957 (lig_2)
   NER (nucleotide excision repair)
    Other NER factors
     AOA65_0957 (lig_2)
   MMR (mismatch exicision repair)
    Other MMR factors
     AOA65_0957 (lig_2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 PrpR_N
Motif
Other DBs
NCBI-ProteinID: KPV64498
UniProt: A0A0P9FYN0
LinkDB All DBs
AA seq 551 aa AA seqDB search
MRYSLIADAYEKIEATTKRLEMTDYLVELLKETPRDLIDKVVYLTQGKLYPDFVGIEIGV
AEKLAIRAVARATGRDEKEIAKDLGKTGDLGETTQKFLEEKAQVTLFQEPLTAQAVYETL
DKMAKTAGPGSMEQKINLLAGLLTSATPREAKYIVRTVTGKLRLGIADMTVLDALAIAYG
GGKEARKGLERAYNISSDLGRVAKTVVEKGMEGVRRFEVSLGEPIRPMLAERLSSPHEIL
EKLGGRCIAEFKYDGERIQAHKRGDEITLFSRRLENITRQYPDGVELFTKYVRAREAIIE
AECVAIDPDTGEMKPFQELMHRRRKYGIKKAMEEYPVSLFMFDALYVDGRDLTLEPYPVR
HQTLMKIIEQSDRVRVADYLITDDPDELEQFFERAIESGCEGVICKSVTEDAVYQAGARG
WLWIKYKRDYKSEMTDTVDLVVVGAFHGRGKRAGTYGALLLAAYDPDEDAFKTVTKCGTG
FTDEDLGKLPKMMEKHRIPHRHPRVSSTLEADVWFEPHVVIEAIGAEITLSPXXXXXXXH
ECDTGGERTSH
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgagatactcgctcatcgcggatgcttacgaaaaaattgaagccacaacaaaaaggctg
gaaatgaccgactacttggtggagcttctcaaagaaactccaagagacctgatcgacaag
gttgtttacttgacgcagggaaaactataccctgactttgttggaattgagatcggcgtt
gcagagaaactagccatacgagcggttgccagagcaacaggtcgcgacgaaaaggaaatt
gcaaaggatttgggaaaaaccggagacctaggcgagacaacccagaaattcttggaggag
aaggcccaagtcacgttgtttcaggaaccgctgaccgctcaagcggtgtacgaaaccctt
gacaagatggcaaagacagcgggcccagggtccatggagcaaaagatcaatcttctggct
gggctcttgaccagcgccacacccagagaggcgaagtacattgttcgaacggtcacgggc
aaattgaggctgggaatcgctgacatgacggttctcgacgctctagctatcgcgtatggc
ggtgggaaagaggctcggaagggtttagagagagcttacaacatttcatccgatttgggt
agggtggcgaaaaccgttgtagagaaggggatggagggcgttagaaggtttgaggtctcg
cttggggagcccatcaggcccatgctggctgagaggctaagctctccccacgaaatcctt
gaaaagcttggaggaagatgcatagccgagttcaagtacgacggggagagaatccaggcc
cacaaacgaggagatgagattactctcttctctcggcgcctcgaaaatatcactcgtcaa
tatcctgacggagtcgaattgttcacgaaatatgtgagggcgagggaggccatcattgag
gcagaatgcgttgccatcgaccccgacacgggtgaaatgaaacccttccaagagctgatg
catcggagaagaaaatacggcataaaaaaagccatggaagagtatcccgtttcgctcttc
atgtttgacgctctctatgtcgacggaagggacctaaccctagagccatacccggttaga
caccaaactcttatgaagatcatcgaacagagtgaccgagttagggtggcggattacctc
atcaccgacgacccagatgaactggagcagttttttgagagagccatagagagcggatgc
gaaggggtaatctgcaaatccgtaaccgaagatgcggtttatcaggcgggagcgagaggg
tggctctggataaagtacaaacgagactataagagtgagatgactgataccgtcgacctc
gtggtggtgggggccttccatgggagggggaaacgagcgggaacctacggcgctctactc
ctcgccgcctacgatccagacgaagatgccttcaaaacggtcaccaagtgcggtactggg
ttcaccgacgaagacctcggaaaactccccaaaatgatggagaaacatcgaataccccac
cgacacccaagagtttcttctaccctggaggcggacgtgtggtttgaaccccacgttgtc
atcgaagccattggagccgagataaccctcagcccnnnnnnnnnnnnnnnnnnnngccat
gaatgtgatacgggaggggagcggactagccattag

DBGET integrated database retrieval system