KEGG   Bathyarchaeota archaeon BA1: AOA65_1846Help
Entry
AOA65_1846        CDS       T04065                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
barc  Bathyarchaeota archaeon BA1
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:barc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AOA65_1846
Enzymes [BR:barc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AOA65_1846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 489 aa AA seqDB search
MKADVVIIGGGIVGVSIARELSQYNVDTVLVEGESDIAFGSTKANTGIIHAGYDDMPGTV
KADLCRRGNALWSELSSELDVPFKRIGSLVVALRDDDIGILEELKERGGKNGVPSLEIIE
DRDRLFQMEPNLSEESIAALYAPTAGIASPYEMAIALVENTLQNGVRVLLETKVGKILVE
KGEVKAVQTNRGCIEANYVINAAGLYADEVSAMVGISHFSITPRKGEYYVLDKRLGGFVN
HVLFPTPTPISKGIVVTPTIDGNLLIGPNAHDIEDKTDVATTFTGLEEVFKGALRLVPNL
SLRKNMIIANYAGLRAEPSTGDFIIEAYDEVKGFINAAGIKSPGLTSAPAIAKKVVNILR
CEGLKLEEKEAFDPYRKSIDRSIRELSFNKAKKLIAQDPTYGHVVCRCEYVTEGEVVEAI
RRGATTLDGVKFRTRAGMGRCQGGFCTPRVIRILSREPAVPMEDVTKRGGNSKLLPYGIK
SLLLGGGVK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggatgttgtgatcattggtggcggaatcgtaggggtatcgatagctcgggag
ctatctcaatataatgtggatactgttttagttgagggggaatccgatatagccttcggc
tccacgaaggcaaacactggcattatccatgcaggctatgatgacatgccagggacagta
aaggctgatttatgtcggcgaggcaatgctttatggtccgagctttcatccgagcttgac
gtgccctttaaaagaataggatctcttgtcgttgccctaagggatgatgacataggcatt
cttgaggaacttaaagagaggggtggaaaaaatggggttccaagcctggagatcatagag
gatcgtgacaggctttttcaaatggagccaaaccttagtgaggaatccatcgctgctcta
tatgccccaacagctgggatagccagtccttatgagatggccatagcattagtggaaaat
actttacaaaatggagtgagagttcttttagagactaaggtcggaaaaattctcgtagag
aaaggggaagtaaaggctgtccagactaatagagggtgtattgaagccaattacgtgatc
aatgcagcagggttatatgctgatgaagtatccgccatggtgggcatatcccatttttcc
attacacctcgaaagggcgagtattatgttctggataaaaggcttggcggtttcgttaac
cacgttcttttccccactcccacccccattagcaagggaatagtggttaccccaaccatt
gacggaaacctgcttatcgggcctaacgcccatgacatagaggataaaactgatgtggct
accaccttcactgggttagaggaagtctttaagggtgcacttaggctagtgccaaatctt
tctttgaggaagaacatgataattgctaactatgctggtctacgcgccgaacccagcact
ggcgacttcataattgaggcatacgatgaagtgaagggatttattaatgcggcaggcatc
aaatcgcccggcttaacatctgccccggcaattgccaaaaaagtagttaatattttaagg
tgcgaggggctaaagctagaggaaaaggaagccttcgatccctatcgcaaatccattgat
agatcaatccgggagctctctttcaataaagcgaagaagctaattgcgcaggatcccacg
tatggtcacgttgtttgtcgttgtgaatacgtgactgagggggaggttgtggaggccatc
cggcggggagccaccacgctggatggggtcaagttccgaactagggcggggatggggcga
tgccaagggggtttttgcactccacgcgttatcagaatcttatctagagagcctgcagtt
ccaatggaggatgtcaccaaacgaggcggcaactctaaactactgccgtatggaattaag
tcgcttttacttgggggcggggtcaaatga

DBGET integrated database retrieval system