KEGG   Buchnera aphidicola Sg (Schizaphis graminum): BUsg311Help
Entry
BUsg311           CDS       T00087                                 

Gene name
pykA
Definition
(RefSeq) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
bas  Buchnera aphidicola Sg (Schizaphis graminum)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUsg311 (pykA)
   01230 Biosynthesis of amino acids
    BUsg311 (pykA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUsg311 (pykA)
   00620 Pyruvate metabolism
    BUsg311 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    BUsg311 (pykA)
Enzymes [BR:bas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     BUsg311 (pykA)
Exosome [BR:bas04147]
 Exosomal proteins
  Proteins found in most exosomes
   BUsg311 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
complement(355536..356981)
Genome map
AA seq 481 aa AA seqDB search
MLNRVRRTKIVATLGPSTDKANNLEKIILSGANVLRLNFSHGSSEEHKKRAKKAKEIMFK
LNCHIALLGDLQGPKIRISKFKKNSIFLKVNDVFILDANLNEKNGNNERVGIDYKKLPND
LNVNDILLLDDGRIQLKVIKIEKCAIFTKVIIGGILSNNKGINKLGGGLSADALTEKDKK
DIILASEIDVDYLAVSFPRCADDLIKARELLKKSGSNAQIIAKIERAEAVFDQNAIENII
LSSDAIMIARGDLGVEIGDAELVGIQKKLIRTARKLNKVAITATQMMESMILNPLPTRAE
VMDVANAVLDGSDAVMLSAETASGKYPSETVISMAKVCKGAEKVPSINVSRHRLNVEFQS
IEEAIAMSSMYAANHLKGITAIITMTESGKTALMTSRITSGLPIFALSKHKKTLNLTALY
RGVIPIYFDSDKDGVEAANEAIILLCKKKFLFNNDLVIVTQGDIMGKIGKTNTSRILRVT
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcgtgttagaagaacaaaaattgtagcaactttaggaccttctacagataaa
gcaaataatcttgaaaagattattttatctggagcaaatgttcttcgtttaaatttttct
catggttcatctgaagaacataaaaaaagagcgaaaaaagcaaaagaaataatgtttaaa
ttaaattgtcatattgctttattaggtgatttacaaggaccaaaaatcagaatttctaaa
tttaaaaaaaacagtatttttttaaaagttaatgacgtttttatattagatgcaaattta
aatgaaaaaaatggaaacaatgaaagagtcggaattgattataaaaaattaccaaatgac
ctaaatgtaaatgatatcttgttgttagacgacggaagaatacaattaaaagtaataaaa
attgaaaaatgtgcaatatttacaaaagttattataggtggcattctatctaataataag
ggtattaataaattaggtggtggtttatcagcagatgcattaacagaaaaagataaaaaa
gatataattcttgcttctgaaattgatgtagattatttggccgtatcgttccctcgttgt
gctgatgatttaataaaagccagagagttattaaaaaaatctggtagtaacgctcaaatt
atagctaaaatagaaagagccgaagctgtatttgatcaaaatgctatagaaaatataata
ttgtcttcagatgcaattatgattgctagaggagacttaggtgtcgaaattggtgatgca
gaattggtaggtattcaaaaaaaattaattagaactgctagaaaattaaataaggtagca
attactgcaacacaaatgatggaatcaatgattttaaatccgttacctactcgtgcagaa
gttatggatgtagccaatgctgtgttagatggaagcgatgcagtcatgctgtctgcggaa
actgcatctggaaaatatccatctgaaactgtgataagtatggctaaagtttgcaaaggg
gcagaaaaagttcctagtattaatgtttctagacatcgtcttaatgtagaatttcaaagc
attgaggaagccattgctatgtcatcaatgtatgcggcgaatcacttaaaaggaattaca
gcaattattactatgacagaatctggtaaaacagcattaatgacttctagaattacttct
ggactaccgatttttgctttatcaaaacataaaaaaactttaaatttaactgctctctat
agaggtgtgattcctatttattttgatagtgataaggatggtgttgaagctgctaatgaa
gcaataattcttttgtgcaagaaaaaatttctatttaataatgatttagtcattgtcact
caaggtgacataatggggaaaataggtaaaacgaataccagtagaattttaagagttaca
tattaa

DBGET integrated database retrieval system