KEGG   Buchnera aphidicola Sg: BUsg311Help
Entry
BUsg311           CDS       T00087                                 

Gene name
pykA
Definition
pyruvate kinase
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
bas  Buchnera aphidicola Sg
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Class
Metabolism; Overview; Carbon metabolism [PATH:bas01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bas01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bas00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bas00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bas00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
complement(355536..356981)
Genome map
AA seq 481 aa AA seqDB search
MLNRVRRTKIVATLGPSTDKANNLEKIILSGANVLRLNFSHGSSEEHKKRAKKAKEIMFK
LNCHIALLGDLQGPKIRISKFKKNSIFLKVNDVFILDANLNEKNGNNERVGIDYKKLPND
LNVNDILLLDDGRIQLKVIKIEKCAIFTKVIIGGILSNNKGINKLGGGLSADALTEKDKK
DIILASEIDVDYLAVSFPRCADDLIKARELLKKSGSNAQIIAKIERAEAVFDQNAIENII
LSSDAIMIARGDLGVEIGDAELVGIQKKLIRTARKLNKVAITATQMMESMILNPLPTRAE
VMDVANAVLDGSDAVMLSAETASGKYPSETVISMAKVCKGAEKVPSINVSRHRLNVEFQS
IEEAIAMSSMYAANHLKGITAIITMTESGKTALMTSRITSGLPIFALSKHKKTLNLTALY
RGVIPIYFDSDKDGVEAANEAIILLCKKKFLFNNDLVIVTQGDIMGKIGKTNTSRILRVT
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcgtgttagaagaacaaaaattgtagcaactttaggaccttctacagataaa
gcaaataatcttgaaaagattattttatctggagcaaatgttcttcgtttaaatttttct
catggttcatctgaagaacataaaaaaagagcgaaaaaagcaaaagaaataatgtttaaa
ttaaattgtcatattgctttattaggtgatttacaaggaccaaaaatcagaatttctaaa
tttaaaaaaaacagtatttttttaaaagttaatgacgtttttatattagatgcaaattta
aatgaaaaaaatggaaacaatgaaagagtcggaattgattataaaaaattaccaaatgac
ctaaatgtaaatgatatcttgttgttagacgacggaagaatacaattaaaagtaataaaa
attgaaaaatgtgcaatatttacaaaagttattataggtggcattctatctaataataag
ggtattaataaattaggtggtggtttatcagcagatgcattaacagaaaaagataaaaaa
gatataattcttgcttctgaaattgatgtagattatttggccgtatcgttccctcgttgt
gctgatgatttaataaaagccagagagttattaaaaaaatctggtagtaacgctcaaatt
atagctaaaatagaaagagccgaagctgtatttgatcaaaatgctatagaaaatataata
ttgtcttcagatgcaattatgattgctagaggagacttaggtgtcgaaattggtgatgca
gaattggtaggtattcaaaaaaaattaattagaactgctagaaaattaaataaggtagca
attactgcaacacaaatgatggaatcaatgattttaaatccgttacctactcgtgcagaa
gttatggatgtagccaatgctgtgttagatggaagcgatgcagtcatgctgtctgcggaa
actgcatctggaaaatatccatctgaaactgtgataagtatggctaaagtttgcaaaggg
gcagaaaaagttcctagtattaatgtttctagacatcgtcttaatgtagaatttcaaagc
attgaggaagccattgctatgtcatcaatgtatgcggcgaatcacttaaaaggaattaca
gcaattattactatgacagaatctggtaaaacagcattaatgacttctagaattacttct
ggactaccgatttttgctttatcaaaacataaaaaaactttaaatttaactgctctctat
agaggtgtgattcctatttattttgatagtgataaggatggtgttgaagctgctaatgaa
gcaataattcttttgtgcaagaaaaaatttctatttaataatgatttagtcattgtcact
caaggtgacataatggggaaaataggtaaaacgaataccagtagaattttaagagttaca
tattaa

DBGET integrated database retrieval system