KEGG   Bacillus atrophaeus NRS 1221A: TD68_18895Help
Entry
TD68_18895        CDS       T03711                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
batr  Bacillus atrophaeus NRS 1221A
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:batr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TD68_18895
Enzymes [BR:batr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     TD68_18895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3829817..3831283
Genome map
AA seq 488 aa AA seqDB search
MSVMTEKNTYLNYINGAWVKSHSGDMVKVENPADIHDLVGYVQNSTAEDVDRAVAAANEA
KAAWRKLSGAERGQYLYKTADIMEQRLDEIAACATREMGKTLPEAKGETARGIAILRYYA
GEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIPIWKMAPALVYGNTVVIK
PATETAITCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAEHNGVNGITFTGSNQVGKI
IGQAALERGAKYQLEMGGKNPIIVTNEADLDAAAEAAITGAFRSTGQKCTATSRVIVQSK
VYDRFKEKLIQRTKDITIGNSLKEDVWMGPIASKNQLDHCLSYIEKGIQEGASLLIGGEK
LEAGDYQNGYYVQPAIFDNVTSDMTIAQEEIFGPVIALLKVGTMEEALDIANDVKFGLSA
SLFTQNIGHMLSFIDDIEAGLVRVNAESAGVELQAPFGGLKQSSSHSREQGEAAKDFFTA
IKTVFIKQ
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgatgacggaaaaaaacacataccttaattatattaatggagcgtgggtcaaa
tcccattcaggcgatatggtaaaggtcgaaaatccggctgatatccatgatcttgtgggc
tatgtgcaaaactcgacggctgaagatgtggaccgggccgtagcggctgcaaatgaagcg
aaagcggcatggagaaagctgtctggcgctgagcggggccaatacttgtacaaaacggct
gatatcatggaacagcgtctggatgaaattgcagcctgcgctacacgcgagatgggtaaa
acactgccggaagcaaaaggggaaaccgccagagggattgccattcttcgatattacgcc
ggagaaggcatgcgcaaaacaggcgatgttatcccgtctactgacaaagatgcgctgatg
tttacaacccgtgttcctctcggggtggtcggcgttatttctccatggaacttcccggtc
gcaatcccgatttggaaaatggctccggcattggtgtacggcaataccgttgtcattaaa
ccagcgacagaaacagctattacctgtgcgaaaatcatcgcatgctttgaagaagcgggg
cttccggcgggcgttatcaatttggtgacaggcccggggtcagtcgtcggccaaggactt
gccgagcataatggagtgaacggcatcacattcaccggatcgaaccaggttggtaaaatc
atcgggcaagccgctttagaacggggagccaagtaccagcttgaaatgggcgggaaaaac
ccgatcatcgtaacaaatgaagccgatcttgatgccgccgctgaagcagcgattaccggc
gcattccgttcgaccggccaaaagtgcacagccaccagccgtgtcattgtacaaagtaag
gtttacgacagattcaaagaaaaattaatacagcgcacaaaagacattaccatcggtaac
agcttaaaagaagacgtatggatgggaccgatcgcaagcaagaatcagcttgatcattgc
ctttcctatatcgaaaaaggaatacaagagggcgcttcccttttgatcgggggagaaaag
ctggaggctggagactatcaaaatggttactatgttcagcccgcaatttttgacaacgtc
acctctgacatgaccattgcccaggaagagattttcggaccggtcatcgccttattgaag
gtcggcacaatggaagaggctttagatatcgccaatgatgtgaagtttggactaagtgct
tcgcttttcacccaaaacatcggccatatgctgtcttttatagatgatattgaagcagga
cttgttcgggtcaacgcagaaagcgcaggggttgaacttcaggctccttttggcggtctc
aaacaatcaagctctcactctcgcgaacagggcgaggcggctaaagactttttcacggcg
attaaaaccgtttttattaaacagtaa

DBGET integrated database retrieval system