KEGG   Bacillus anthracis H9401: H9401_1973Help
Entry
H9401_1973        CDS       T02028                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00473  D-Alanine metabolism
bax01100  Metabolic pathways
bax01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    H9401_1973
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    H9401_1973
Enzymes [BR:bax01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     H9401_1973
Peptidoglycan biosynthesis and degradation proteins [BR:bax01011]
 Precursor biosynthesis
  Racemase
   H9401_1973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF4170
Motif
Other DBs
NCBI-ProteinID: AFH83359
LinkDB All DBs
Position
1937125..1938351
Genome map
AA seq 408 aa AA seqDB search
MKREIEWNAIIELGVRPMSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKAN
GYGHGAVEVAKAAIEAGINQLAIAFVDEAIELREAGINVPILILGYTSVAAAEEAIQYDV
MMTVYRSEDLQGINEIANRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVV
GMFTHYSTADEIDKSYTNMQTSLFEKAVNTAKELGIHIPYIHSSNSAGSMEPSNTFQNMV
RVGIGIYGMYPSKEVNHSVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGHALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQG
EENIAVEEIADMLGTINYEVTCMLDRRIPRVYKENNETTAVVNILRKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaaatagaatggaatgcaattattgagttaggagttagaccaatgagtttg
aaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacataatgtaaaa
gaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgtaaaagcgaat
gggtatggtcatggggcagttgaagttgcaaaagctgctattgaagcaggaataaatcag
cttgcaattgcatttgtagatgaagcgatagagttaagagaagcaggaattaacgtgccg
attttaattttaggctatacatcagtagcggctgcggaagaagcaattcaatatgacgtt
atgatgaccgtttatagaagtgaagatttacaaggtataaatgaaatcgcaaaccgtctt
caaaagaaagcgcaaattcaggtgaaaattgatacaggaatgagtcgcattggtttacag
gaagaagaggttaaaccatttttagaggaattaaaacgtatggagtatgtagaggtagtg
ggaatgtttacacattactctacggcagatgaaatcgataaatcatatacgaatatgcaa
acaagtttatttgagaaagctgtcaatacagcaaaagaattaggaattcatattccatat
attcatagttcaaatagtgcaggttcaatggaacctagcaatacatttcaaaatatggtt
cgtgtaggtatcggaatttatggaatgtatccttcaaaagaggtaaatcattcagttgtt
tcgttacagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcatgcgaagaaa
aatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatggattgccacc
gtaccgattggttatgctgatggttataatcgtcagttgtctaataaagggcatgcatta
ataaatggagttcgagtacctgttattggccgtgtttgtatggatcagctcatgttagac
gtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggtaaacaaggc
gaagaaaacatcgcagtagaagaaatagcggatatgttaggtacaattaactatgaagtt
acatgtatgttagatagaagaattccacgtgtgtataaagaaaataatgaaacaactgct
gttgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system