KEGG   Bacillus anthracis H9401: H9401_4672Help
Entry
H9401_4672        CDS       T02028                                 

Definition
(GenBank) Acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00010  Glycolysis / Gluconeogenesis
bax00620  Pyruvate metabolism
bax00640  Propanoate metabolism
bax00680  Methane metabolism
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01120  Microbial metabolism in diverse environments
bax01130  Biosynthesis of antibiotics
bax01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_4672
   00620 Pyruvate metabolism
    H9401_4672
   00640 Propanoate metabolism
    H9401_4672
  Energy metabolism
   00680 Methane metabolism
    H9401_4672
Enzymes [BR:bax01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     H9401_4672
Lipid biosynthesis proteins [BR:bax01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   H9401_4672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFH86058
LinkDB All DBs
Position
complement(4438672..4440264)
Genome map
AA seq 530 aa AA seqDB search
MFMKREELLAPPSYNLVSEIEKYTGDKEKLALIWQDDKGNRREVTYAELMKGANKIGNAF
IKSGLQKGDKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIV
SYEPYIGQFDDIEAMESLQKFVLSERSVDGWINLKTALETESDMLEMAKTDKEDMVFLSY
TSGTTGNPKGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGS
GATGFVYHGKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGE
PLNREVIETFQKHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVDEEG
MPVRVGEVGDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRG
DDIIISSGYTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETL
IPILQQHVKELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgaagagagaggaattgttggcaccaccgtcttataatttagtttctgaaata
gagaaatatacaggtgataaagagaagcttgctttaatttggcaagatgataaagggaat
cgacgagaagttacatacgctgagctaatgaaaggtgcaaataaaattggaaacgctttt
ataaagagtggtctgcaaaaaggggacaagctcctcattatgatgccgcgtttaattgaa
gcgtacatgacgtatatcgcagcgattaaagcaggatttgtcgtaattccgagttcggaa
atgttacgcaaaaaggatatcgaatatcgcattggacacggggaagtaaaagcaatcgta
agttatgagccttacattggacagtttgatgatatagaagcgatggaatcccttcaaaag
ttcgttctgagcgagcggtcagtagatggatggatcaatttaaaaacagcgttagaaaca
gaaagtgacatgttagaaatggcgaagacagataaagaagatatggtctttttatcttac
acgtcaggaacgacaggaaatccaaaaggtgttgttcatacgcatgcgtgggcatacgct
catttacgtacaagcgctccgaattggctcggaattgaagagaatgatgttgtatgggca
acagctagtccaggctggcagaagtggatttggagcccgtttttagcaactctaggctcg
ggggcaacaggatttgtataccacggtaagtttgaaccaaaaacgtatttaaatttatta
gacgataataaggtgaatgtactttgttgtacgccaactgagtatagattaatggcaaaa
gtagaaaatttaagcgagtacaatttagaagcgttacatagcgctgtatccgcaggtgag
ccgttaaatagagaagtcattgaaacgttccaaaagcactttcatattacagtgagagac
ggctatgggcaaacggaaaatacattgcttgttggtgtaatgaaagggatggatattaga
ccaggatcaatggggaaaccgacgccaggcaaccacgttgatattgtagatgaggaaggg
atgccagtaagggtaggcgaagttggtgatattgcggttcatattgaaacaccagccctc
tttaaacaatactataaagacgatgagcgcacagcgatgcaattccgcggtgattattat
attaccggtgataaagcaaagaaagatgaagacggctatttctggtttgaagggcgcggt
gatgatattattattagctctggttatacaatcgggccgtttgaagtagaagatgcgctc
gtaaagcacccttatgtaagagaatgtgcggttgtcgcaagtcctgatgaaattcgcgga
agtgtcgtgaaggcatttatcgtattaagagagaatatagaaaagaacgaagaaacatta
attccaatactccaacaacacgtcaaggaacttactgcaccatataaataccctcgcaaa
attgaatttgtagatgaactaccaaaaacgatttctggaaaaatccgccgtattgaactt
agaaaacaagagatggagattccgtcaaaataa

DBGET integrated database retrieval system