KEGG   Bacillus velezensis FZB42: RBAM_019130Help
Entry
RBAM_019130       CDS       T00582                                 

Gene name
odhA
Definition
(GenBank) OdhA
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00020  Citrate cycle (TCA cycle)
bay00310  Lysine degradation
bay00380  Tryptophan metabolism
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01120  Microbial metabolism in diverse environments
bay01130  Biosynthesis of antibiotics
bay01200  Carbon metabolism
Module
bay_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bay_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBAM_019130 (odhA)
  Amino acid metabolism
   00310 Lysine degradation
    RBAM_019130 (odhA)
   00380 Tryptophan metabolism
    RBAM_019130 (odhA)
Enzymes [BR:bay01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RBAM_019130 (odhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ABS74275
UniProt: A7Z5J9
LinkDB All DBs
Position
complement(2031610..2034444)
Genome map
AA seq 944 aa AA seqDB search
MFQNNMKQRMNWEDFYGPNLGYALELYDQYAEDPDSIDPDLKDMFDELGAPPSQIKEASG
TKEQGRVTADLIQKIAAAVKLAEDIRTYGHLNASVNPLRKDPKKSELFPLSDYGLTEEEM
KAIPASVICKDAPANITNGLEAIQHLRNTYKRTISFEFDHVHDFEERAWITKMVESGELF
RKNSPEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKAGTT
NVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSTGISYGWTGDVKYHLG
ADRQLQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQKGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESDESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKRFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKRIFAEKLVSEGLISEEKAQNIETAVTKRIEDAYKKVPAKKEDAVREIELPE
PVSNGFPDVDTAIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGEEFVALHHLDDCAASFTVHN
SPLSEGSVLGFEYGYNVYSPETLVMWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFKPVYEQSGLSHAYEKVTRVVLSSGKVSIDISDHF
NKMEGDKDWLHIARIEQLYPFPAKDTKELFAKLPNLQEIVWVQEEPQNMGAWSYISPYLS
EIAPKGVNVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaataatatgaaacaaagaatgaattgggaagatttttacggaccgaacctc
ggctacgcactggagctgtacgaccaatatgctgaagatccagacagcattgatccggat
ctgaaagacatgtttgacgaactcggcgctccgccaagccaaataaaagaggcatcggga
acaaaggaacagggacgcgtcaccgcagatctgattcaaaagatcgcagcagcagttaaa
cttgcagaagatattcgaacctatggccatctgaacgcttccgtcaatccgctcagaaag
gatccgaaaaagagcgagctctttccgttatccgattacgggcttacagaagaagaaatg
aaagcaatacccgcgtctgtcatctgtaaagacgcacctgccaatataacaaacggctta
gaagccatccagcatttacgcaatacctataaaagaaccatctccttcgagtttgaccat
gtgcatgatttcgaagagcgcgcatggattacaaaaatggtcgaatccggagaactgttc
cggaaaaattcaccggaaaaactgtcagccgttttagaaagactgacggaagtagaagga
tttgaacaatttttacaccggacattcgtcggtcagaagcgtttctcaattgagggatta
gacgcgcttgtgccggttcttgacgacattatcgcccagtctgtgaaagcgggcacaacc
aatgtcaatatcgggatggcgcacagaggccgtttaaatgtgcttgcgcatgtgctcggc
aaaccgtatgagattattttctcagaattccagcatgcgccgaataaagaccttgtgccg
tctgaaggatcgaccggcatcagctacggctggacgggcgatgtaaaataccacctcggt
gcagacagacagcttcaggatgctgaaaccaaaagtgcgcggattacgcttgcaaataac
ccgagccacttggaattcatcaatccgattgtggaaggaagcacgcgggcggcacaggaa
acaagaacgcaaaaggggtacccggttcaagacgaaacaaaatcgctcgccattttaatt
cacggtgacgcagcgtttccgggagaaggcattgtcgccgagacgctgaacttaagctct
ctgaaaggctatcaggtcggcggggccattcatatcatcgccaataatatgatcggcttt
acaactgaaagcgatgaatcacgatccacgaaatatgccagtgatttggcgaagggctat
gaaattccgatcgttcacgtcaacgcggatgatccggaagcatgcctgtcagccgttaaa
tttgcggttgaataccggaagcggttcaataaagatttcttaatcgatttaatcgggtac
agacggtacggccacaatgaaatggatgagccgtcaacgacacagccgatgctgtatgac
gccgtcagaaaacacccgactgtcaagcggatctttgcggaaaaactcgtaagtgaaggt
ctgatcagcgaggaaaaagcgcaaaacatcgaaacggcagtgacaaaacgaattgaagac
gcctataaaaaggtgcccgccaaaaaagaagacgccgtacgggaaattgaattgccggaa
ccggtgtccaacggttttccagacgttgacacagccattgactttgatgttctccgcaag
ctgaacggcgaacttatcaactggccggaatcttttaacgtgttcggcaagctgaaaaga
atcctggaaagacgtgcaaaagcgtttgatgatgaccgtaaagttgaatggtcattggct
gaatcgcttgcgtttgcttccattttgaaagacggcacgccgatccggctgaccggacag
gattcagagcgcggaacgttcgctcaaagaaaccttgtgctgcatgacagcgaaacagga
gaagaatttgttgccctccatcacttagacgactgcgctgcttcatttacggtgcataac
agcccgctctctgaaggatcggttctcggctttgaatatggatacaacgtgtattcgcct
gaaacgcttgtgatgtgggaggcgcagtacggggactttgctaatgcggctcaagtctat
tttgatcaattcatatctgcaggacgggcaaaatggggacaaaaatcaggactggtcatg
ctgctgcctcacggttacgaagggcagggccctgaacactccagcggccgcgtcgagcgg
ttcctgcagctggcggcggaaaacaactggacggtggccaacctgacaagtgcggctcag
tatttccacattttaagaagacaagcgaaaatgctgcttcgtgaggaaatccgcccgctt
gtgatcatgacgccgaagagcctgctgcgcaacccgaatacggtatctgaagtgcaggaa
ctgagcgaaagccgattcaagcctgtctatgagcagtccggtctttcccatgcttacgaa
aaagtgactcgcgtcgtattatcaagcggaaaagtgtcaattgatatcagcgatcacttc
aacaaaatggaaggcgataaggattggcttcatattgccagaatcgaacagctgtatccg
ttcccggcaaaagatacgaaggagcttttcgccaaactgccgaacctgcaagagatcgtt
tgggttcaggaagagccgcagaacatgggggcatggagttatatcagcccgtatctgtcg
gaaatcgcgccaaaaggagtaaatgtccaatacatcggccgaagaagacgatccagtccc
gcagaaggagatccgacagtccacaaaaaagaacaggaacgcattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system