KEGG   Bacillus velezensis FZB42: RBAM_036890Help
Entry
RBAM_036890       CDS       T00582                                 

Gene name
aldX
Definition
(GenBank) AldX
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bay  Bacillus velezensis FZB42
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBAM_036890 (aldX)
   00053 Ascorbate and aldarate metabolism
    RBAM_036890 (aldX)
   00620 Pyruvate metabolism
    RBAM_036890 (aldX)
  Lipid metabolism
   00071 Fatty acid degradation
    RBAM_036890 (aldX)
   00561 Glycerolipid metabolism
    RBAM_036890 (aldX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RBAM_036890 (aldX)
   00310 Lysine degradation
    RBAM_036890 (aldX)
   00330 Arginine and proline metabolism
    RBAM_036890 (aldX)
   00340 Histidine metabolism
    RBAM_036890 (aldX)
   00380 Tryptophan metabolism
    RBAM_036890 (aldX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RBAM_036890 (aldX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RBAM_036890 (aldX)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RBAM_036890 (aldX)
Enzymes [BR:bay01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RBAM_036890 (aldX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3797618..3798955
Genome map
AA seq 445 aa AA seqDB search
MDQHIKADIKRVFELQKKNQKTLRASTAGQRREKLQRFLDAVTAHEEEIIEAIRRDVRKP
YHEVKRAETQGTIKAIKDNMNNLDTWMAPKRVGSSVSPDADGVLMYEPKGLTLILGPWNY
PFMLTMAPLAAAIAAGNSAIVKLSDFTMETSHIAATVIREAFHEEEVAIFEGEVDVATEL
LDQPFDHIFFTGSTNVGKIVMTAAAKHLSSVTLELGGKSPTIIDSGYDLMDAAKKIAVGK
FVNAGQTCIAPDYLLMKKEVQSTFTDLLQTIVNAGFMEDDHTVDRNKFTQIVNDRNFNRV
KALYDDAIEKGAKTAFGGVFDAHDRTISPTVLTNVTPDMKIMQEEIFAPILPIMNYEDIS
EAVDYITERDKPLALYVFSHNQELIDYVLQHTTSGNASVNDVVVHFTDVNLPFGGVNTSG
IGSYHGVYGFKEFSHEKGVFIQASK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcatataaaagcagacatcaaacgcgtctttgagcttcagaaaaaaaatcaa
aaaacgctgcgtgcttcaacagccgggcagcgcagagaaaagcttcagcgctttttagat
gccgtcaccgcacatgaagaagaaatcattgaggcgatcagacgggacgtccgcaagcct
tatcatgaggtgaaaagagcggaaacgcagggaacgatcaaggcgattaaagataatatg
aacaatctcgacacctggatggcgccgaaacgcgtcggctcatccgtcagccccgacgct
gacggcgtattaatgtacgagccaaaaggccttaccttaattctcggcccgtggaattat
ccgtttatgctgacgatggctccgcttgcagctgccattgcggccggcaacagcgcgatt
gtgaagctgtccgattttacaatggagacgagccatatcgccgcgacagttattcgcgag
gcatttcatgaagaagaagtcgccatttttgaaggtgaggtcgatgtcgccacagaactg
ctcgaccagccgtttgaccacattttcttcaccggaagcacgaatgtcggtaaaatcgtc
atgacggcagcggcgaagcacttgtcgtccgtcacgcttgagcttggcggaaaaagcccg
acgatcatcgacagcggctatgatttgatggacgcggcgaaaaaaatcgccgtcggcaaa
tttgtcaatgcggggcaaacatgtatcgcacctgactatctccttatgaagaaagaagtg
cagagcacctttacagatctcctgcaaaccattgtcaatgcaggttttatggaggatgat
catacggttgaccgcaacaaattcacgcagattgtcaacgaccgcaactttaaccgtgtc
aaagccctgtatgatgacgccattgaaaaaggggcgaaaacggcgttcggcggcgtattc
gatgcgcatgaccgcacgatttctccgaccgtgctgacaaacgtgacgcctgatatgaag
atcatgcaggaagaaatcttcgcaccgattctgccgattatgaattacgaagatatcagt
gaagccgttgattacatcactgaacgggacaagccgcttgccttgtatgtattcagccat
aatcaggagctgatcgattatgtgctgcagcatacgacatccggcaatgcttctgtcaat
gatgtcgtcgttcatttcactgacgtcaaccttccgttcggcggtgtcaatacgagcggg
atcggttcatatcacggtgtgtacggctttaaagaattttctcatgaaaaaggcgtattt
attcaagcctctaaataa

DBGET integrated database retrieval system