KEGG   Bdellovibrio bacteriovorus HD100: Bd2630Help
Entry
Bd2630            CDS       T00159                                 

Definition
(GenBank) trypsin
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
bba  Bdellovibrio bacteriovorus HD100
Brite
Enzymes [BR:bba01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Bd2630
Peptidases [BR:bba01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Bd2630
Exosome [BR:bba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bd2630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2546497..2547267)
Genome map
AA seq 256 aa AA seqDB search
MKMNHLVIAGLMMMSAPVFAKSGSVGAKIVGGVEASIGEFPYIVSLQSGSHFCGGSLIKK
NWVLTAAHCVRGGTVKKVVIGLHDRTNAVNAESIAPKRIIAHPNYNARTMENDFALIELS
QDSSYAPVALNPAEIALPTDGSEIMTTVAGWGATREGSYSLPTKLQKVDVPLVSSEACNK
AYNNGITDSMICAGYEGGGKDSCQGDSGGPLVAQDENNQTYLVGVVSWGQGCARAKYFGV
YAKVSNAIEWINNTAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaaccatcttgttatcgcaggcctcatgatgatgtctgctccagtattcgcg
aaatctggctctgtaggggctaaaatcgttggtggcgttgaggcttccatcggtgagttc
ccatacatcgtgtctttgcagagcggcagccatttctgcggcggttccttgatcaagaag
aactgggtattgacagcagctcactgtgttcgtggtggcactgtgaagaaagttgtgatc
ggcctgcatgaccgtaccaacgcggtgaatgcagaatccatcgctccaaaaagaattatc
gctcacccgaactacaatgcccgcacaatggaaaatgactttgcattgatcgagctttct
caggattcttcttacgctccagtggcgttgaatcctgcagagatcgctttgccaacagac
ggttctgaaatcatgacaactgtggctggctggggtgcgactcgtgaaggttcttactct
ttgccgacgaaattgcaaaaagtggacgttccattggtttcttctgaagcttgtaacaaa
gcctacaacaacggcatcacggacagcatgatctgtgctggttacgagggtggtggtaaa
gactcttgccagggtgactctggcggtccgttggtggctcaggacgaaaacaaccagacg
tatctggtgggcgttgtgagctggggtcagggttgtgctcgtgcgaagtactttggtgtt
tatgccaaagtcagcaacgcgatcgagtggatcaacaacacggctcagtaa

DBGET integrated database retrieval system