KEGG   Bdellovibrio bacteriovorus 109J: EP01_08275Help
Entry
EP01_08275        CDS       T03079                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bbac  Bdellovibrio bacteriovorus 109J
Brite
Enzymes [BR:bbac01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EP01_08275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1715192..1715773
Genome map
AA seq 193 aa AA seqDB search
MTFELPALPYAKDALAPHMSAETLEYHHGKHHKTYVDNLNKLVPGTEHEGKTLEQIIMSS
SGGVFNNAAQIWNHTFFWNCLSPKGGGEPTGELAQAIVRDFGSIEKFKELFADASIKQFG
SGWGWLVKNKEGKLEILSTSNAETPMTKGHTAILTCDVWEHAYYIDYRNSRPNFLAAFWK
LVNWEFAAKNFKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgaacttccagcacttccctacgctaaagacgctttggctccgcacatgtcc
gctgagacattggaataccaccacggtaaacaccacaaaacctacgttgataacctgaac
aaacttgttcccggcacagaacacgaaggcaaaactttagagcaaatcatcatgagcagc
tctggcggcgtgtttaacaacgcagctcagatctggaatcacacgttcttctggaactgc
ctgtccccaaagggcggcggcgagcctaccggtgaactggcgcaagccatcgttcgcgat
ttcggttccatcgaaaaattcaaagagctgttcgcggatgccagcatcaaacaattcggc
tcgggctggggctggcttgtgaaaaacaaagaaggcaaattggaaatccttagcaccagc
aatgccgaaaccccgatgaccaaaggtcacacggcgattctgacttgtgatgtgtgggaa
catgcatattacatcgactatcgcaacagccgcccgaacttcctggcagccttctggaag
ctggtgaactgggaatttgctgcaaaaaactttaaaggctaa

DBGET integrated database retrieval system