KEGG   Brevibacillus brevis: BBR47_13840Help
Entry
BBR47_13840       CDS       T00879                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00010  Glycolysis / Gluconeogenesis
bbe00230  Purine metabolism
bbe00620  Pyruvate metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01200  Carbon metabolism
bbe01230  Biosynthesis of amino acids
Module
bbe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bbe_M00002  Glycolysis, core module involving three-carbon compounds
bbe_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bbe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_13840 (pyk)
   00620 Pyruvate metabolism
    BBR47_13840 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    BBR47_13840 (pyk)
Enzymes [BR:bbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     BBR47_13840 (pyk)
Membrane trafficking [BR:bbe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BBR47_13840 (pyk)
Exosome [BR:bbe04147]
 Exosomal proteins
  Proteins found in most exosomes
   BBR47_13840 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C PEP-utilizers HpcH_HpaI DRTGG NAPRTase
Motif
Other DBs
NCBI-ProteinID: BAH42361
NITE: BBR47_13840
UniProt: C0Z7W8
LinkDB All DBs
Position
1423784..1425538
Genome map
AA seq 584 aa AA seqDB search
MLRKAKIVCTIGPASESVETLKKLIEAGMNVARLNFSHGSHEEHAARIVNIRQASKETGK
PVAILLDTKGPEIRTGTLAVDAVELVEGNTLILTTEEVAGTAERVSITYPELPRDVKIDD
TILIDDGLIGLTVQEVRGTEIICLIKNGGTLKSKKGVNVPGVKINLPGITEKDAQDIEFG
IEQGVDFIAASFVRKASDILEIRQILERHNVRIDIIAKIENQEGVDNVDDILVVTDGIMV
ARGDLGVEIPAEEVPLVQKKLIKKCNELAKPVITATQMLDSMQRNPRPTRAEASDVANAI
FDGTDAIMLSGETAAGKYPVESVETMVRIAVRAEQELNYREILYAQAQLKQVTITDAISQ
AVSNAALDLDAAAIITATESGHTARMVSKFRPKAPIVAVTPHEAIIRRLALVNGVYPVKG
EMANTTDEMLEMSVQEALDAGFVRHGDLVVITAGVPVREVGTTNLMKIHVIGDVVAKGQG
IGRKVVTNKVVIARSAEEALAKVEEGAILVTIGTDSDMIEAFGKAGAVICEEGGLTSHAA
IVGLNLGVPVIVGVQFATDVLKDGQIVTVDSERGHIYSGHARIL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggaaagcaaaaattgtatgtaccatcggaccagcgagtgaatcggttgaaacg
ctgaagaaactaattgaagcaggaatgaacgtagcccgtttgaatttctcgcacggttcc
cacgaggagcatgcggcgcgaatcgtaaacattcgtcaggcatcaaaagaaaccgggaaa
cccgttgcaatcctgttggatacaaaaggtcctgaaattcgcacgggtacgctggcagta
gatgcagtcgagctcgtagaaggaaatacgctgatcctcaccacggaggaagtagcgggt
accgcagagcgcgtctccattacgtatccggaattgccacgtgatgtgaaaatcgacgat
acgatcttgatcgacgacggcttgatcgggttgactgtacaagaagtgcgtggcaccgaa
atcatctgcttgatcaaaaacggtggaacactgaagagcaaaaaaggcgtaaatgttcct
ggtgttaaaatcaacttgccaggtatcacagaaaaggatgcgcaggatatcgaattcggt
attgaacaaggagtcgatttcatcgcggcttccttcgtccgaaaagcatcggatatcttg
gagattcgccaaattctggagcgccataacgtgcgtatcgatattatcgcgaaaattgaa
aaccaggaaggcgtcgataacgtagacgatattctggtagtaacagatggaatcatggtt
gcgcgtggtgatttgggcgtagagattccggcagaagaagtaccgcttgttcaaaagaag
ctgatcaaaaaatgtaacgaactcgcgaagccagtcattacggcaacacaaatgcttgat
tctatgcagcgcaacccacgtccaacacgtgcggaagcaagtgacgttgcgaacgccatt
ttcgatgggacagacgcaatcatgctctccggagagacggctgccggtaaatatccggtt
gagtctgtcgagaccatggtgcggatcgctgtacgtgcagagcaagagctgaattatcgt
gaaatcttgtatgcacaagcacagcttaaacaagtgacgattacggatgcgatcagccaa
gctgtatccaatgcagcattggatctggacgctgcagcaattattacagcgaccgaaagc
ggacacactgctcgcatggtatcaaagttccgtccgaaagcaccaatcgtggctgtaaca
ccgcatgaggcgattattcgccgtcttgcactcgtaaatggcgtgtatccagtgaagggc
gaaatggcgaatacaaccgatgaaatgctggagatgtctgttcaagaggcgcttgatgca
ggcttcgttcgtcatggcgatctcgttgtgatcacagcaggcgtgcctgtgcgtgaagtt
gggacaacgaacctgatgaaaatccacgtcattggcgatgtggtagcaaaaggacaaggt
atcggccgcaaagttgtcacaaacaaggtagtgattgctagatcagctgaagaggcactg
gcaaaggtagaagaaggagcaatcctggtaaccatcggtacggactccgatatgatcgaa
gcgtttggcaaggcaggagcggtgatttgcgaagagggcggacttacctctcacgcagct
atcgtaggcctgaatctcggcgttccagtcatcgtaggagtgcaatttgctacggatgta
ttgaaggatggacaaatcgttacagtggattccgagcgcgggcatatttactcaggacac
gcacggattctgtag

DBGET integrated database retrieval system