KEGG   Brevibacillus brevis: BBR47_13840Help
Entry
BBR47_13840       CDS       T00879                                 

Gene name
pyk
Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
bbe  Brevibacillus brevis
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBR47_13840 (pyk)
   01230 Biosynthesis of amino acids
    BBR47_13840 (pyk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_13840 (pyk)
   00620 Pyruvate metabolism
    BBR47_13840 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    BBR47_13840 (pyk)
Enzymes [BR:bbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     BBR47_13840 (pyk)
Exosome [BR:bbe04147]
 Exosomal proteins
  Proteins found in most exosomes
   BBR47_13840 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
1423784..1425538
Genome map
AA seq 584 aa AA seqDB search
MLRKAKIVCTIGPASESVETLKKLIEAGMNVARLNFSHGSHEEHAARIVNIRQASKETGK
PVAILLDTKGPEIRTGTLAVDAVELVEGNTLILTTEEVAGTAERVSITYPELPRDVKIDD
TILIDDGLIGLTVQEVRGTEIICLIKNGGTLKSKKGVNVPGVKINLPGITEKDAQDIEFG
IEQGVDFIAASFVRKASDILEIRQILERHNVRIDIIAKIENQEGVDNVDDILVVTDGIMV
ARGDLGVEIPAEEVPLVQKKLIKKCNELAKPVITATQMLDSMQRNPRPTRAEASDVANAI
FDGTDAIMLSGETAAGKYPVESVETMVRIAVRAEQELNYREILYAQAQLKQVTITDAISQ
AVSNAALDLDAAAIITATESGHTARMVSKFRPKAPIVAVTPHEAIIRRLALVNGVYPVKG
EMANTTDEMLEMSVQEALDAGFVRHGDLVVITAGVPVREVGTTNLMKIHVIGDVVAKGQG
IGRKVVTNKVVIARSAEEALAKVEEGAILVTIGTDSDMIEAFGKAGAVICEEGGLTSHAA
IVGLNLGVPVIVGVQFATDVLKDGQIVTVDSERGHIYSGHARIL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggaaagcaaaaattgtatgtaccatcggaccagcgagtgaatcggttgaaacg
ctgaagaaactaattgaagcaggaatgaacgtagcccgtttgaatttctcgcacggttcc
cacgaggagcatgcggcgcgaatcgtaaacattcgtcaggcatcaaaagaaaccgggaaa
cccgttgcaatcctgttggatacaaaaggtcctgaaattcgcacgggtacgctggcagta
gatgcagtcgagctcgtagaaggaaatacgctgatcctcaccacggaggaagtagcgggt
accgcagagcgcgtctccattacgtatccggaattgccacgtgatgtgaaaatcgacgat
acgatcttgatcgacgacggcttgatcgggttgactgtacaagaagtgcgtggcaccgaa
atcatctgcttgatcaaaaacggtggaacactgaagagcaaaaaaggcgtaaatgttcct
ggtgttaaaatcaacttgccaggtatcacagaaaaggatgcgcaggatatcgaattcggt
attgaacaaggagtcgatttcatcgcggcttccttcgtccgaaaagcatcggatatcttg
gagattcgccaaattctggagcgccataacgtgcgtatcgatattatcgcgaaaattgaa
aaccaggaaggcgtcgataacgtagacgatattctggtagtaacagatggaatcatggtt
gcgcgtggtgatttgggcgtagagattccggcagaagaagtaccgcttgttcaaaagaag
ctgatcaaaaaatgtaacgaactcgcgaagccagtcattacggcaacacaaatgcttgat
tctatgcagcgcaacccacgtccaacacgtgcggaagcaagtgacgttgcgaacgccatt
ttcgatgggacagacgcaatcatgctctccggagagacggctgccggtaaatatccggtt
gagtctgtcgagaccatggtgcggatcgctgtacgtgcagagcaagagctgaattatcgt
gaaatcttgtatgcacaagcacagcttaaacaagtgacgattacggatgcgatcagccaa
gctgtatccaatgcagcattggatctggacgctgcagcaattattacagcgaccgaaagc
ggacacactgctcgcatggtatcaaagttccgtccgaaagcaccaatcgtggctgtaaca
ccgcatgaggcgattattcgccgtcttgcactcgtaaatggcgtgtatccagtgaagggc
gaaatggcgaatacaaccgatgaaatgctggagatgtctgttcaagaggcgcttgatgca
ggcttcgttcgtcatggcgatctcgttgtgatcacagcaggcgtgcctgtgcgtgaagtt
gggacaacgaacctgatgaaaatccacgtcattggcgatgtggtagcaaaaggacaaggt
atcggccgcaaagttgtcacaaacaaggtagtgattgctagatcagctgaagaggcactg
gcaaaggtagaagaaggagcaatcctggtaaccatcggtacggactccgatatgatcgaa
gcgtttggcaaggcaggagcggtgatttgcgaagagggcggacttacctctcacgcagct
atcgtaggcctgaatctcggcgttccagtcatcgtaggagtgcaatttgctacggatgta
ttgaaggatggacaaatcgttacagtggattccgagcgcgggcatatttactcaggacac
gcacggattctgtag

DBGET integrated database retrieval system