KEGG   Brevibacillus brevis: BBR47_13840Help
Entry
BBR47_13840       CDS       T00879                                 

Gene name
pyk
Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
bbe  Brevibacillus brevis
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:bbe01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbe01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbe00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bbe00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bbe00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
1423784..1425538
Genome map
AA seq 584 aa AA seqDB search
MLRKAKIVCTIGPASESVETLKKLIEAGMNVARLNFSHGSHEEHAARIVNIRQASKETGK
PVAILLDTKGPEIRTGTLAVDAVELVEGNTLILTTEEVAGTAERVSITYPELPRDVKIDD
TILIDDGLIGLTVQEVRGTEIICLIKNGGTLKSKKGVNVPGVKINLPGITEKDAQDIEFG
IEQGVDFIAASFVRKASDILEIRQILERHNVRIDIIAKIENQEGVDNVDDILVVTDGIMV
ARGDLGVEIPAEEVPLVQKKLIKKCNELAKPVITATQMLDSMQRNPRPTRAEASDVANAI
FDGTDAIMLSGETAAGKYPVESVETMVRIAVRAEQELNYREILYAQAQLKQVTITDAISQ
AVSNAALDLDAAAIITATESGHTARMVSKFRPKAPIVAVTPHEAIIRRLALVNGVYPVKG
EMANTTDEMLEMSVQEALDAGFVRHGDLVVITAGVPVREVGTTNLMKIHVIGDVVAKGQG
IGRKVVTNKVVIARSAEEALAKVEEGAILVTIGTDSDMIEAFGKAGAVICEEGGLTSHAA
IVGLNLGVPVIVGVQFATDVLKDGQIVTVDSERGHIYSGHARIL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggaaagcaaaaattgtatgtaccatcggaccagcgagtgaatcggttgaaacg
ctgaagaaactaattgaagcaggaatgaacgtagcccgtttgaatttctcgcacggttcc
cacgaggagcatgcggcgcgaatcgtaaacattcgtcaggcatcaaaagaaaccgggaaa
cccgttgcaatcctgttggatacaaaaggtcctgaaattcgcacgggtacgctggcagta
gatgcagtcgagctcgtagaaggaaatacgctgatcctcaccacggaggaagtagcgggt
accgcagagcgcgtctccattacgtatccggaattgccacgtgatgtgaaaatcgacgat
acgatcttgatcgacgacggcttgatcgggttgactgtacaagaagtgcgtggcaccgaa
atcatctgcttgatcaaaaacggtggaacactgaagagcaaaaaaggcgtaaatgttcct
ggtgttaaaatcaacttgccaggtatcacagaaaaggatgcgcaggatatcgaattcggt
attgaacaaggagtcgatttcatcgcggcttccttcgtccgaaaagcatcggatatcttg
gagattcgccaaattctggagcgccataacgtgcgtatcgatattatcgcgaaaattgaa
aaccaggaaggcgtcgataacgtagacgatattctggtagtaacagatggaatcatggtt
gcgcgtggtgatttgggcgtagagattccggcagaagaagtaccgcttgttcaaaagaag
ctgatcaaaaaatgtaacgaactcgcgaagccagtcattacggcaacacaaatgcttgat
tctatgcagcgcaacccacgtccaacacgtgcggaagcaagtgacgttgcgaacgccatt
ttcgatgggacagacgcaatcatgctctccggagagacggctgccggtaaatatccggtt
gagtctgtcgagaccatggtgcggatcgctgtacgtgcagagcaagagctgaattatcgt
gaaatcttgtatgcacaagcacagcttaaacaagtgacgattacggatgcgatcagccaa
gctgtatccaatgcagcattggatctggacgctgcagcaattattacagcgaccgaaagc
ggacacactgctcgcatggtatcaaagttccgtccgaaagcaccaatcgtggctgtaaca
ccgcatgaggcgattattcgccgtcttgcactcgtaaatggcgtgtatccagtgaagggc
gaaatggcgaatacaaccgatgaaatgctggagatgtctgttcaagaggcgcttgatgca
ggcttcgttcgtcatggcgatctcgttgtgatcacagcaggcgtgcctgtgcgtgaagtt
gggacaacgaacctgatgaaaatccacgtcattggcgatgtggtagcaaaaggacaaggt
atcggccgcaaagttgtcacaaacaaggtagtgattgctagatcagctgaagaggcactg
gcaaaggtagaagaaggagcaatcctggtaaccatcggtacggactccgatatgatcgaa
gcgtttggcaaggcaggagcggtgatttgcgaagagggcggacttacctctcacgcagct
atcgtaggcctgaatctcggcgttccagtcatcgtaggagtgcaatttgctacggatgta
ttgaaggatggacaaatcgttacagtggattccgagcgcgggcatatttactcaggacac
gcacggattctgtag

DBGET integrated database retrieval system