KEGG   Bacillus beveridgei: BBEV_0492Help
Entry
BBEV_0492         CDS       T05114                                 

Gene name
ppc
Definition
(Genbank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bbev  Bacillus beveridgei
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bbev00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBEV_0492 (ppc)
  Energy metabolism
   00680 Methane metabolism
    BBEV_0492 (ppc)
Enzymes [BR:bbev01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBEV_0492 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
564933..567701
Genome map
AA seq 922 aa AA seqDB search
MAKLNEKDPNTMLRSDVNKLGKILGDVLKHHGGQELFEEVEDIREMTKALRKNYDKARED
ELKKRIENLKSPMRQQVIRAFAIYFHLVNIAEQHHRIRRSRQYRMKRGENIQPSSIESAV
VNIQKEDYPESVIQQVLNDSSIELIMTAHPTEATKRTILEIQKRISFILEQFDNPVLTEK
EREDYEESLVNEVTALWQTDELRFKKPTVIDEVKNGLYYFDTTLFDVLPAVHLEIEEQLE
RYYPGKNFTVPNFIHFGSWIGGDRDGNPFVTPEVTWETLNLQRGLTLRKYEESITELMRR
FSQSTTRVDIDPEFIATMEKYEKEYMKKAETWPVTTEVYRRMLGVMRKRIRQVGKTNTGY
DVAEELLEDLRYVRKHALKHQLPDQKLKRLNKMIRQVELFGFHLATLDVRNHSGEHETAI
AEILKVVGITDDYKALSEEEKMTILENALKDPRPLMLLNEDYSKETREIFKVFQMIKDAH
DEFGYRSIEVYLVSMTQSASDLLEVLVLAKEAGIYRLHADGTVDSNLHVAPLLETVDDLM
AGPAIMKRLFEMDTYRNHLSERGDHQEIMLGYSDGSKDGGTLTANWKLFEAQAKIHNMAK
EYNVRLKFFHGRGGSLGRGGGPLNRSILSQPAETLGDGVKITEQGEVLSSRYLLGDIAFR
NLEQAASALLEASANVYATPDDSCHARRPHWEEAMEEISKASLDKYQSLVFKDADFLTYF
KETTPLNELKELNIGSRPMSRKGSEKFEDLRAIPWVFAWTQCRQMLPAWYASGTGLAHYA
NQSEENMAMLQEMYQKWPFFHSTINNLQMALMKADLFAAKEYVKLVKDQEMGQRIYGNIE
SEFNLTKEMLLKISQSNELLDFSPNIRDSVHLRNPYVDPLNFLQVDLIEKMRESSTEEHT
DELLTEVLLTISGVAAGLLNTG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcttaatgagaaagatccgaacaccatgcttcgcagtgatgtgaataagctg
ggcaagatcttaggggatgtattgaaacatcacggaggccaggaactcttcgaagaagtg
gaagacattcgtgaaatgaccaaggcgcttcgtaaaaactacgacaaagcgagagaagat
gaactgaaaaaacggattgagaatttgaagtctccgatgaggcaacaggtgatccgggca
tttgcgatctatttccacctggtgaatatcgctgaacagcaccaccggatccgccgttcc
aggcagtaccggatgaaacgcggcgaaaacattcagccaagttcgatcgaatcagcagtg
gtgaacattcaaaaggaagattatccggagtctgtcatccagcaggtgttaaacgattcg
tccattgagctgattatgaccgctcatccgacggaggcgacgaagcggacgattttagag
attcaaaaacggatctcgtttatccttgagcaatttgataaccccgttctcaccgagaaa
gagcgggaagattatgaagagagtctcgttaatgaagtgacggcactctggcagaccgac
gagctccgtttcaaaaaaccgacggtcattgatgaagtgaagaacggtttatactatttt
gatacgacactgtttgacgtactgcctgcggtccacctggaaattgaagaacagttggag
cgttattatcccgggaagaattttactgtcccgaactttattcatttcggttcctggatt
ggcggcgacagggatgggaacccgtttgtcacacctgaagtgacatgggaaacgttgaac
ctgcagcgcggtctgacgctcaggaagtacgaagaaagtattacggaactgatgcgccgt
ttcagtcaatcgactacccgtgtggacattgacccggaatttatcgccaccatggagaaa
tacgagaaagaatatatgaagaaagccgaaacgtggcctgtcacgacagaagtctaccgg
cgaatgctaggtgtcatgcggaaacggatccgccaggttggtaaaacgaacacaggctac
gatgtggcagaagagcttctcgaagatcttcgctacgtgcgaaagcatgccttaaagcat
cagttgcctgatcagaaattgaagcgtctgaataagatgatccgtcaggtcgaactgttc
ggttttcatctggcgactctcgatgtccgaaaccacagtggcgaacatgaaaccgcgatt
gcggaaatccttaaagtcgtcggcattactgatgattacaaggcactgagtgaagaagaa
aaaatgacgattctggaaaatgcgttgaaagaccctcgtccactgatgctgttaaatgaa
gattactcgaaggaaacccgtgaaatcttcaaagtattccagatgatcaaggatgcgcat
gacgagtttggttaccgctccattgaagtgtatcttgtcagtatgacccaatctgcctca
gatcttttggaagtgctggtgctggcaaaagaagcgggcatttaccgcctccacgcagat
ggtaccgtggacagcaacctgcatgtggcaccgcttcttgagacggtcgatgacctgatg
gcagggccggcgattatgaaacggctgtttgaaatggatacgtaccgcaaccatctttct
gaacggggggatcatcaggaaatcatgctgggatactccgacggcagtaaggatggcggg
accttgacggcgaactggaagctctttgaagcccaggcgaagattcataacatggccaag
gaatacaatgtccgcctgaaatttttccatggaagaggcgggtcccttgggcgtggcggc
ggtccattgaaccgcagtattctctctcagccggcggaaaccctgggggacggtgtcaag
atcacagagcagggcgaagtgttgtcttcccggtatctcttaggggatattgcctttcgg
aacctggaacaggcggcgtctgccttactcgaagcctcggcgaatgtttacgcaacgcct
gatgacagctgccatgcacgccggccgcattgggaagaagcgatggaggagatctccaag
gcatcccttgacaaatatcagtccctcgtattcaaagatgctgatttcctgacgtatttt
aaagaaaccacgccattgaatgaattgaaggagctgaacatcggctcacgtccgatgagc
cgaaaaggcagtgaaaaattcgaagacctccgggccattccgtgggtatttgcctggacc
cagtgccgtcagatgctgcctgcctggtatgcatcaggaacaggactggctcactatgcc
aaccagagtgaagagaacatggccatgcttcaggagatgtatcagaagtggccgttcttc
cattccaccatcaataacctgcagatggcgctgatgaaagcagacctgtttgcggcgaag
gaatacgtgaaactcgtgaaggatcaggaaatgggtcaacggatttacgggaacatcgaa
tctgaatttaatttgacaaaagagatgctgttgaagatatcccagagtaacgaattgctg
gatttctcaccaaatatccgggattcggttcacctgcgaaatccgtacgtcgatccactg
aacttcctgcaagtggatctgatcgagaaaatgcgcgagtcctccaccgaagaacatacc
gatgaactcctgacagaagtcctgctcaccatcagtggtgtggcagccggactcttaaat
acaggttga

DBGET integrated database retrieval system