KEGG   Bacillus beveridgei: BBEV_2606Help
Entry
BBEV_2606         CDS       T05114                                 

Definition
(Genbank) hypothetical protein
Organism
bbev  Bacillus beveridgei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2775029..2777173)
Genome map
AA seq 714 aa AA seqDB search
MKIAIVYNRESQAVINLFGTPNREKYGLETIKKIKDGLQTLGHQVKTFEGDKNIIQKLEE
YMPSVISGERPGLVFNLSYGIQGKGRYMHVPGILEMIGVPYVGSGPETHAMALDKVVTKM
ILLQKGLPTPRFAELEKPDSPITAELTYPLIVKPKNEAVSFGLKIVHNEEELREGVKIIY
DNFHSPTLVEEYIEGREVNVGLLGNSPVQALPAVELTFGEGPQIYTYEDKTSGQGSRVQK
VCPAPLGDELTAKVQKLAIDTFHALNCFDTARVDFRIDKDGNPYILEVNSMASLGADGSF
VYAAQTLGMSYAEIMNRIVEVTSERYFGPQFVVSADESGEKKGMDLFEVITKNRSGLEKD
LKMWTNMSSRTEDPVGLSSVRKKIEERAAKLGLQLNKQYTNGRSAWTWETKKGFKDGTLL
VVPIDVPGDRTGYPVPYRTEQEWIYGEGVASSRGGLTTMFHALTALKDTKKLSPRKIGVF
FYADEGRGMRYSTAAFEQAVEHAGEVIVLQPGFMEGKIVDQRRGFKQFNVIVEGDPVRMG
KSTRDPDVLTYFIKRADELQSLSNRRKKLAVAMQDVKSERYSVLMPHRVVATFSITYIDP
ELARQAEKQLRETFNSNGTSIRTYVEEIVDRKPMSRKKNHPLRDRLHELSESWNIPYGTE
SSLLPSAAGIVPKDIPAICGFAPASKDLFTPNEALHRRELAQRTLLLALHLEGE
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattgcaatcgtttataaccgtgaaagccaggcagtcatcaatttgttcgggaca
ccgaaccgtgaaaaatacggacttgaaacgatcaaaaaaatcaaagacggcctccagacc
ctcggccatcaggtgaagacgtttgaaggggataagaacatcattcaaaagctggaggag
tatatgccttcggtgatttccggtgaacggccggggctcgttttcaacctgagctacggc
attcagggaaaaggcaggtacatgcacgtaccgggcattcttgagatgatcggggtcccc
tacgtaggaagcggtccggagacccatgccatggcccttgacaaggttgtcaccaagatg
attctcctgcaaaaaggccttccgacaccacggttcgccgaactggaaaaaccggactca
cccatcaccgcagagttgacctatccactcattgtcaaaccgaaaaacgaagcggtctcg
ttcggcctgaagatcgttcataacgaagaagaactgcgtgagggtgtgaaaatcatttac
gataattttcattccccgacgcttgtggaagaatatatcgaaggccgtgaagtcaatgtc
ggcctgctcggaaacagtccggtgcaggcactgccggcggtggaactgaccttcggtgag
ggtccgcagatttatacgtacgaagacaaaaccagtggtcagggaagccgtgtccaaaaa
gtatgtccggctccgcttggcgatgaattaaccgccaaagtccagaagcttgccattgat
acgtttcatgccctgaactgctttgatacggcacgggtggatttcagaattgataaagac
ggaaatccatacattctcgaggtgaattccatggcctcattgggcgcggatgggtccttc
gtctacgctgcccagacgcttggcatgagctacgcggagatcatgaaccggattgtcgaa
gtgaccagtgaacggtatttcggaccgcagttcgtcgtcagtgccgatgaatccggcgag
aaaaaaggcatggatctctttgaagtaatcacaaagaaccgctccggactcgagaaagac
ctgaagatgtggacgaatatgtccagccggacagaagatccggtaggtctcagttcagtc
cgcaaaaaaatagaagaacgggctgcaaaactcggtcttcagttgaacaaacaatacaca
aatggccgttcagcctggacatgggaaactaagaagggttttaaagacggtacactgctg
gtggttccgattgacgtcccgggcgaccgcaccggctatccggttccttaccgcacagag
caggaatggatctacggcgaaggcgtggcctcaagtcgcggggggttaacgacgatgttt
cacgccctgacagccttgaaggatacgaaaaaactctcgccccggaaaattggtgtcttc
ttctatgccgacgaaggcagagggatgcgctacagtacggccgcctttgaacaggctgtt
gaacacgccggggaagtgatcgtgcttcagcctggcttcatggaaggaaaaatcgttgat
cagcgccggggattcaaacagtttaatgtcattgtggaaggggaccctgtccgcatgggg
aaatccacccgtgacccggatgtcctcacgtatttcatcaaacgggcagacgaactgcaa
tccctctccaaccgccgcaagaaacttgccgtggccatgcaggatgtaaagagtgaacgc
tacagcgtactgatgccgcaccgggtggtggcaacattctccatcacgtatattgatcct
gaactggcccgacaggcggagaaacagcttcgggagacgttcaacagtaacgggacatcg
atccggacgtatgtggaagaaatcgttgaccgcaagccgatgagccggaaaaagaatcat
ccgctcagagaccgcctccatgaactcagtgagtcctggaatattccttatgggacggaa
tccagtctgttgccgagcgctgcgggcattgtaccgaaggacatcccggcaatctgcgga
tttgcaccggcaagtaaagacctgtttacaccgaacgaagcccttcaccgccgtgaactg
gctcagcggacattgttactggctctgcatcttgaaggagagtga

DBGET integrated database retrieval system