KEGG   Bordetella bronchiseptica 253: BN112_1504Help
Entry
BN112_1504        CDS       T02344                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bbh  Bordetella bronchiseptica 253
Brite
Enzymes [BR:bbh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BN112_1504 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1608271..1608849)
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYALDALAPRISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEEIVKKS
SGGVFNNAAQVWNHTFYWNSLSPNGGGEPTGALADAIKAKWGSVDAFKEAFNKSAAGNFG
SGWTWLVKKADGSLDIVNTSNAATPLTTADKALLTCDVWEHAYYIDYRNARPKYLENFWA
LVNWEFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcacacactcttccccccctgccttacgctctggatgcgctggctccgcgcatttcc
aaggaaacgctcgagtttcactacggcaagcaccaccagacgtacgtcaccaacctgaac
aacctgatccccggcacggagttcgagaacctgtcgctggaagagatcgtcaagaagtcc
tcgggtggcgtgttcaacaatgccgcccaggtctggaaccacacgttctactggaacagc
ctgtcgcccaacggcggcggcgagcccaccggcgcactggccgatgccatcaaggccaag
tggggcagcgtggacgccttcaaggaagccttcaacaagtcggccgccggcaacttcggc
tcgggctggacctggctggtcaagaaggcggacggttcgctggacatcgtcaacaccagc
aacgccgccacgccgctgacgaccgccgacaaggcgctgctgacctgtgacgtttgggag
cacgcgtactacatcgattaccgcaatgcccgtcccaagtacctggaaaacttctgggcg
ttggtgaactgggaattcgccgcgaagaatttcgcctaa

DBGET integrated database retrieval system