KEGG   Bifidobacterium bifidum S17: BBIF_0038Help
Entry
BBIF_0038         CDS       T01328                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBIF_0038
  Energy metabolism
   00680 Methane metabolism
    BBIF_0038
Enzymes [BR:bbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBIF_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(46509..49265)
Genome map
AA seq 918 aa AA seqDB search
MTDTDQQITPADATIVSTGTGTKGPEERELPESLSNDMSLCLRILRDVLGEYDPQLLATF
DTVRNYAVKASAEHFAGATADPHPDEDGLAKAVATIDAMNLHDAQLLARAFATYFHLANL
SEENYRVSVLHQRENQVEDDEAVDPVNELTTAYHQLLTEMGPAKAKALLEKLEFHPVFTA
HPTEARRKAVEGKIRRIAELLEENKRLGGSDKKENVRRLYNEIDALFRTSPIALKKPTPV
EEADTILDIFDNTLFTTIPKVYHRFNDWLLGDKAGLEQPQCPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVISALEEATRTVGRNLTMESETTPASAELKSLWSHQKEMSERLT
DKAALISTKELHRAVMLVMADRLRYTIERDADLMYHSCDDFIADLQVVQRSLAEAGAKRS
AYGPLQDLIWQAQTFGFHMVEMEFRQHSVVHARALEDIREHGLHGERGELQPMTHEVLDT
FRALGAIQKRNGIKAARRYIISFTKSAQNVRDVYELNRLAFSHPEDVPVIDVIPLFEQLE
DLQNCVNVLEEIVKIPEVQARLKATGNKMEVMLGYSDSSKDAGPTTATLALHSAESRIVA
WAAKHDIDLTLFHGRGGAVGRGGGPANRAVLAQPKGSVNCRFKLTEQGEVIFARYGNPVL
AIRHLESVAAATLLQSAPSVEKTNTEMTEKYAHMTEVLDNASHERFLDLLNTPDFAPWFS
IVTPLTEVGLLPIGSRPAKRGLGAKSLDDLRTIPWVFSWAQARINLAAWYGLGSACEKFG
DLDTLREAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDDENLSKKVLDEMKLTTKW
VLKIVNDEWPLQHRHVLGQAIRIRSPYVDALSVTQVLALRSLRKKVDKEELSKSQQAGFI
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataccgatcaacagatcacgcccgccgacgcgaccatcgtgtcgaccggcacc
gggaccaagggccccgaagagcgggagctgcctgagtcgctcagcaacgacatgagcctg
tgcctgcgcattctgcgcgacgtactgggcgaatatgacccgcagctgctggcgacgttc
gacaccgtgcgcaactacgcggtgaaggcaagcgccgagcatttcgccggagcgacggcg
gatccgcaccccgatgaggatggtctggcaaaggccgtcgccaccatcgatgcgatgaat
ctgcacgacgcccagctgctcgcccgcgcattcgccacatatttccacctcgccaacctg
agtgaggagaactaccgcgtttccgtgctgcaccagcgcgagaaccaggtggaagacgac
gaagccgttgacccggtgaacgaactgaccaccgcctaccatcagctgctgaccgaaatg
gggccggccaaagccaaggcgttgctggagaagctcgaattccacccggtgttcacggcg
catccgaccgaagcgcgccgcaaggcagtcgaaggcaagatccgccgcatcgcggagctg
ctggaagagaacaagcgcctcggcggctccgacaagaaggagaacgtccgccgcctctac
aacgagatcgacgcgctgttccgcacgtccccgatcgcgctgaagaagccgacgccggtc
gaggaggccgataccatcctcgacatcttcgacaacacgctgttcaccacgattcccaag
gtctaccaccgtttcaacgactggctgctgggcgacaaggccggtctcgaacagccgcag
tgcccggcgttcttccatccgggaagctggatcggctccgaccgcgacggcaacccgaac
gtcaccgccaaggtcagccgtcaggtcgcccgcaagttcagcgaccatgtgatcagcgcc
cttgaggaggccacccgcacggtcggccgcaacctgaccatggagtccgagacgaccccg
gccagcgccgagctgaagagcctgtggagccaccagaaggagatgagcgagcgcctgacc
gacaaggccgcactgatctccaccaaggagctgcaccgcgccgtcatgctggtgatggcc
gatcgcctgcgctacaccatcgagcgcgacgccgacctcatgtaccacagctgcgacgat
ttcatcgccgacctgcaggtcgtgcagcgttccctggccgaagccggcgccaagcgttcg
gcgtatggcccgctgcaggatctgatctggcaggcgcagaccttcggcttccacatggtc
gagatggagttccgtcagcactccgtggtgcacgcccgcgcgctggaggacatccgcgag
cacggcctgcacggcgagcgtggcgaactgcaaccgatgacgcacgaggtgctcgacacc
ttccgcgccctcggtgccatccagaagcgcaacggcatcaaggccgcccgccgctacatc
atctcgttcacgaagagcgcccagaacgtgcgcgacgtgtacgagctgaaccgtctggcg
ttttcgcacccggaggatgtgccggtcatcgacgtcatcccgctgttcgagcagcttgag
gacttgcagaactgcgtgaacgtgctggaagagatcgtcaaaatccccgaggtgcaggct
cgtctgaaggccaccggcaacaagatggaggtcatgctcggctactcggattcgtccaag
gacgccggcccgaccaccgctacgctggcgctgcattccgccgaatcgcgcatcgtcgct
tgggccgcgaagcatgacatcgacctgacgctgttccacggccgtggtggcgccgtcggt
cgaggcggtggccccgccaaccgcgcggtgctcgcccagccgaagggctccgtcaactgc
cgcttcaaactcaccgagcagggcgaggtcattttcgcccgctacggcaacccggtgctg
gccatccgccatctggaatccgtcgccgccgcgacgctgctgcagtccgctccgagcgtc
gagaagacgaacacggagatgaccgagaagtacgcccatatgaccgaggttctggacaac
gcctcgcatgagcgcttcctcgacctgctgaacacgccggacttcgccccgtggttctcg
atcgtcacgccgcttaccgaggtcggcctgctgccaatcggctcccgcccggccaagcgt
ggtttgggcgcgaagtcgctcgacgacctgcgcacgattccgtgggtgttctcctgggct
caggcgcgcatcaacctcgccgcatggtatggccttggttcggcctgcgagaagttcggc
gaccttgacacgctgcgcgaggcgtacgaggagtggccgctgttctccacgttcatcgac
aacatcgagatgtcgctggccaagaccgatgagcgcatcgccaagatgtacttggcgctc
ggcgatgacgagaacctgtcgaagaaggtgctcgacgagatgaagctcaccaccaagtgg
gtgctcaagatcgtcaacgacgaatggccgctgcagcaccgtcacgtgctcggtcaggcc
atccgcatccgctccccttacgtggacgcgctgtccgtcactcaggtgcttgcgttgcgt
tcgctgcgcaagaaggtggacaaggaagagctcagcaagagccagcaggcgggattcatc
tatctgatcctgtgcaccgtctccggtgtcgccgccggcctgcagaacacgggctga

DBGET integrated database retrieval system