KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_597Help
Entry
BLBBGE_597        CDS       T00995                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLBBGE_597 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    BLBBGE_597 (sucA)
   00380 Tryptophan metabolism
    BLBBGE_597 (sucA)
Enzymes [BR:bbl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BLBBGE_597 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(597127..599892)
Genome map
AA seq 921 aa AA seqDB search
MSDRYSFLNTIHFQDLEFLYNKYKKDPNSIESSWSAFFHGFDFGKENYKTDRQSINQENH
KKFLKNENEIDIIHKEFLVFNLIHAYRKRGHFFTPTNPIRERRKHFPSLDLKNFGLSDKE
LDISFEAGKLIGLGRTSLRNIIDYLKNIYCGSIGIEYMYISNPDKIQWIEKWFQKEKLQF
SAEEKKFFLKKLNEAVAFENFIHTKFVGQKRFSIEGNESALPALEEMIEYTSRKYFTEDF
IIGMSHRGRINLLSNFFQKNLSQIFSEFQGKEYKEKTFSGDVKYHLGFSKIRKTSQGRYI
KMNLVPNPSHLESVDAIVEGITRAKIDIIYNQNSNSEKIIPILIHGDAALAGQGIVYEVI
QLSRLKGYKTGGTIHIVLNNQIGFTTNYTEGRSSIYCTDIAKIVLSPVLHVNADDVESVI
RAIHFAVDFRMQYHEDVFIDLLGYRKYGHNEGDEPRFTQPSLYKAISKHPNSYNLYKQKL
EKEGIINSDEIINMEKEYEQILNGGYHEAINIKWNVLNSFLEEEWKNFPIVSNHEDIFHK
VDTRIPMKKIVDISNQVFSLPKNKKFFRKTESIFQQRLEMIQLKLVDWSMAEILAYGTLL
DEGVHIRLSGEDVARGTFSQRHAIVKTEEEEEIILLNHIRMGQGKMQVYNSPLSEYGVLG
FDYGYAMYSPHVLTLWEAQFGDFGNGGQIIIDQYISSGENKWKISNGIVLLLPHGYEGQG
PEHSSARVERYLQLCANNNLFVVNCTTPANFYHLLRRQMKLKYRKPLIVFTPKSLLRNPK
CLSTIEDLSEGKFQEILDDPSVIDIHQITRLIFCSGKIYYELLNKKEALKNDKTALIRIE
QIYPLKMEKIKELLIKYKNKKEVFWVQEEPENMGLWSFILRKLGSIISFNLIAPSESSSP
STGSYPDFLKIQNKILEKAFF
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatagatattcttttctaaatactattcattttcaagatttagaatttctatat
aacaagtataaaaaagatcctaattcaatagaatccagttggagcgcttttttccatgga
tttgattttggaaaagaaaattacaaaaccgatcgtcaatcaataaatcaagaaaatcac
aaaaaatttttaaaaaatgagaatgaaattgatatcatccacaaggaatttttggtgttt
aatttgattcatgcttatagaaaaagaggtcatttttttactcctacaaatcctatacga
gaaagaagaaaacattttccttctttggatttaaaaaattttggtttatctgataaagaa
cttgacatatcttttgaagctggaaaattaataggtcttggaagaacttcattaagaaac
ataatcgattatctaaaaaatatttattgtggatctataggaatagaatacatgtatatt
tccaaccctgacaaaattcaatggattgaaaaatggtttcaaaaagaaaaattgcaattt
tctgcagaagaaaaaaagttttttttgaaaaaattaaatgaagcagttgcgttcgaaaat
tttattcacaccaaatttgtggggcaaaaaagattttctatagaaggaaatgaatctgca
ttacctgcattagaagagatgatagaatatacatccagaaaatattttaccgaagatttt
ataattggaatgtcacatagaggacgtataaatcttctttctaatttttttcaaaaaaat
ctttctcaaatatttagtgaatttcaaggaaaagaatacaaagaaaaaaccttttctggt
gatgtaaaataccatcttggattttctaaaatcagaaagactagtcaaggacgatatatt
aaaatgaatttagttcctaatccttctcatttagaatccgtagatgctattgtagaagga
attacacgtgcaaaaatagatattatttataatcaaaacagtaattcagaaaaaattatt
cctattttaattcatggagatgcagcgttagcaggtcaggggattgtatatgaagttatt
caattatctagattaaaaggatacaaaactggaggaacaattcatatcgtactaaataat
caaataggttttaccacaaattatactgaaggacgttctagtatttattgtactgatata
gcaaaaattgttctttctccagtgttacatgttaatgcagatgatgtagaatctgttata
cgagcaattcattttgctgtagattttagaatgcaatatcatgaagatgtttttatagat
ttacttggatatagaaaatatggacacaatgagggagatgaacctaggtttacacaacct
tctttatataaagctatttctaaacatcccaattcttacaatttgtataaacaaaaatta
gaaaaagaaggaatcattaatagtgatgaaataatcaatatggaaaaagaatatgaacag
attttgaatggaggatatcatgaagcaataaatataaaatggaatgtattgaattctttt
ttagaagaagaatggaaaaattttcctattgtatctaatcatgaagatatttttcataaa
gtcgatactcgaattccaatgaaaaaaattgtagatatatccaatcaagttttttctctt
cctaagaataaaaaattctttagaaaaacggaatcgatttttcaacaaagattagaaatg
attcagcttaaattggtggattggagtatggcagaaatactagcgtatggaacacttttg
gatgaaggtgttcatattcggttatcaggagaagatgtggctagaggaacattttctcaa
cgtcatgccattgtaaaaacggaagaagaggaagaaattattctattgaatcatatccga
atgggacaaggaaaaatgcaagtttataattctcctctttcagaatatggagttttgggt
tttgattatggatacgctatgtattctcctcatgttttaaccttatgggaagctcaattt
ggagattttggaaatgggggacaaattataatagatcaatacatctcctctggagaaaat
aaatggaaaattagcaatggaattgttttattacttcctcatggatatgaagggcaaggg
ccagaacattcatctgcacgtgtagaacgttatttgcaactttgtgctaacaataattta
tttgtggtcaattgtacgactccagctaacttttatcatcttttaagaagacaaatgaaa
ttgaaatatagaaaacctcttatagtttttactcccaaaagtttacttagaaatccaaaa
tgcttatctacaatagaagatctttctgaaggaaaatttcaagaaattttggatgacccc
tctgtgatagatattcatcaaattactagattaattttttgttctggaaaaatatattat
gagcttctcaataaaaaagaggcccttaaaaacgataaaacggcattaattcgcatagaa
caaatttatccattaaaaatggaaaaaattaaagaattacttattaaatacaaaaacaaa
aaagaagttttttgggtacaagaagaaccagagaatatgggattatggagttttatttta
agaaaattgggaagtataatatcattcaatttaatcgctccatctgagagttctagtcca
tctacaggatcttatccagattttttaaaaattcaaaataaaatattagaaaaagctttt
ttttga

DBGET integrated database retrieval system