KEGG   Bradyrhizobium sp. BTAi1: BBta_2328Help
Entry
BBta_2328         CDS       T00528                                 

Gene name
gst
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BBta_2328 (gst)
Enzymes [BR:bbt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BBta_2328 (gst)
Transporters [BR:bbt02000]
 Other Transporters
  Pores ion channels [TC:1]
   BBta_2328 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABQ34500
RhizoBase: BBta_2328
UniProt: A5EEA6
LinkDB All DBs
Position
2410504..2411121
Genome map
AA seq 205 aa AA seqDB search
MLKLYVAPGTCALASHIALAETGAAYAIEKLSFKTNQQNSPEYLAINPKGRVPALVTEQG
ILTETPAMLAYIAQRFPQARLAPLDDIFAFAEVQSFTSYLCSTVHIAHAHKMRGYRWANE
ESSFADMKTKVPETMGACFALIEQKMLRAPWVMGEQYTICDPYLFTIAQWLEGDGVDINA
FPKVADHFKRMSDRPAVQKALAELA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagctctatgtcgcgccaggcacctgcgcgctcgcctcccacatcgcgctcgcc
gaaaccggcgccgcttacgcgatcgagaagctcagcttcaagaccaaccagcagaacagc
ccggagtatcttgcgatcaatcccaaggggcgggtgccggcgctggtgacggagcagggc
atcctgaccgagacgccggcgatgctcgcttatatcgcccagcgcttcccacaggcgcgg
cttgcgccgctcgacgatatcttcgcctttgccgaggtgcagtccttcaccagctatctc
tgctcgacggtccacatcgcccacgcccacaagatgcgcggctatcgctgggccaacgag
gagtcgtccttcgccgacatgaagacgaaggtgccggaaacgatgggcgcctgcttcgcg
ctgatcgagcagaagatgctgcgcgcgccgtgggtgatgggggagcagtacacgatctgc
gatccgtatctgttcacgatcgcgcagtggctcgaaggcgatggggtcgacatcaacgcg
tttccgaaggtcgccgatcatttcaagcgcatgtcggaccggccggccgtgcagaaggcg
ctggcggagctggcctga

DBGET integrated database retrieval system