KEGG   Bradyrhizobium sp. BTAi1: BBta_2928Help
Entry
BBta_2928         CDS       T00528                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBta_2928 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BBta_2928 (ppc)
   00680 Methane metabolism
    BBta_2928 (ppc)
Enzymes [BR:bbt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBta_2928 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
3045045..3047831
Genome map
AA seq 928 aa AA seqDB search
MSPQTMPSEDIRPSRAADAQAMEEDARLRDDIRLLGRILGDTVRDQEGADVFDLVERIRQ
TSVRFHRDEDRQARRELEQILDGMTIAETVRIVRAFSYFSHLANIAEDQNNIRRMRARSD
ANGGAGMLAATLAHAKSAGFEAADLRKFFSTALVSPVLTAHPTEVRRKSTMDREMEVAML
LDRRERMQLTPDEREANDEALRRAVLTLWQTNLLRRTKLTVLDEVTNGLSFYDYTFLREV
PRLLCTLEDRLNDGAEVAGDLASFLRMGSWIGGDRDGNPFVTAEVMRGTLKLQSSLALHY
YLEELHLLGGELSIAAHLADVSEELRALAERSPDTSPHRSGEPYRLAVSGIYARLAATAK
KLGIQISRLPVGVGAPYDSVKQFQDDLDVLHRSLIANNAEVIARGRLRLLRRAVDCFGFH
LARLDIRQNSTVHERTVAELIDTAMPGMSYMALSEDARVGLLVSELRNTRPLVSQFVKYS
DETVGELELFRAAAEAHATFGADVISQCIISMCKGMSDMLEVALLLKEVGLIDPSGRCAV
NIVPLFETIEDLQASSGIMDRMLALHDYRRLVDSRGAVQEVMLGYSDSNKDGGFVTSGWE
LYKAEIGLVEIFERHGIRLRLFHGRGGSVGRGGGPSYDAIIAQPGGAVNGQIRITEQGEI
ISSKYSNAEVGRNNLEILAAATLEASLLHPRQPAPKREYLTAMDRLSELAFKAYRGLVYE
TDGFVDYFWASTVINEIATLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRLMLPGWYGF
GSAVETWIAENPEQGMPFLRELYQEWPFFRMLLSNMDMVLAKSSIAIASRYAELVPDEAL
REKIFGRIRREWHLAIETLLDIMGQERLLQGNPLLERSVRNRFPYLDPLNHVQVELLKEH
RAQNPDEQVLRGIQLTINGISAGLRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgcaaaccatgccgtccgaggacatccggcccagtcgcgctgctgacgcccag
gccatggaggaggatgcccgcctccgggacgatatccggctgctcggccgcattctcggc
gacaccgtgcgcgaccaggagggcgccgacgtcttcgatctcgtcgagcgcatccgccag
acctcggtgcgctttcaccgcgacgaggaccgccaggccaggcgtgagctggaacagatc
ctcgacggcatgacgattgctgaaaccgtgcgcatcgtgcgcgccttcagctatttctcg
catctcgccaacatcgccgaagatcagaacaatatccgccgcatgcgcgccaggagcgac
gccaatggcggggcgggcatgttggcggccacgctcgcccatgccaaatcggccgggttc
gaggccgccgacctgcgcaagttcttctcgaccgcgctcgtcagtcccgtcctcaccgcg
cacccgactgaggtgcggcgcaagagcacgatggaccgcgagatggaggtagccatgctg
ctcgaccgccgcgagcggatgcagctgacgccggacgagcgcgaggccaatgacgaggcg
ctgcgccgggcggtgctgaccctgtggcagaccaatttgttgcgccggaccaagctgacg
gtgcttgacgaggtcaccaacgggctgtcgttctacgactacaccttcctgcgcgaggtg
ccgcgcctgttgtgcacgctggaggatcgtctcaatgacggcgccgaggtcgcgggtgat
ctcgcctccttcctgcgcatgggcagctggatcggcggcgaccgcgacggcaatccgttc
gtgaccgcggaggtgatgcgcggaacgctgaagctgcaatccagcctcgcgctgcattat
tacctcgaggaactgcatctgctcggcggcgaactgtcgattgcggcgcatctcgccgat
gtctccgaggagctgcgcgcgctggctgaacgctcgcccgacacctcaccccaccgcagc
ggcgagccctatcgtctggcggtgtccggcatctatgcgcggctggcggcgacggcgaaa
aagctcggcatccagatcagccggctgccggtgggggtgggggcgccctatgacagcgtc
aagcagttccaggacgatctcgacgtgctgcaccgttcgctgatcgccaacaacgccgag
gtgatcgcgcgcggccggctgcggctgttgcggcgcgcagtggactgtttcggattccat
ctggcccggctcgacatccggcagaattcgacggtgcacgagcgcacggtggccgagctg
atcgataccgccatgcccggcatgtcctacatggcgctcagcgaggatgcgcgggtcggg
cttctggtcagcgagttgcgcaatacccggccgctggtgtcgcagttcgtcaaatacagc
gacgagacggtcggcgagctcgagctgttccgggccgccgccgaggcccatgccaccttc
ggcgccgacgtgatctcgcaatgcatcatctcgatgtgcaagggcatgtccgacatgctc
gaggtcgcgctgctgctcaaggaagtcggtctgatcgatccgtccggccgctgcgccgtc
aacatcgtgccgctgttcgagaccatcgaggatctgcaggcctccagcggcatcatggac
cggatgctggcgctgcatgattatcgccgcctggtcgacagccgcggcgccgtccaggag
gtcatgctcggctattccgacagcaacaaggacggcggcttcgtcacctccggctgggaa
ctgtacaaggcagagatcggcctcgtcgaaatcttcgagcggcatggcatccgtctcagg
ctgttccatggccgcggcggctcggtcggccggggcggcggcccgagctatgacgcgatc
atcgcccagcccggcggcgccgtgaacggccagatccgcattaccgagcagggcgagatc
atctccagcaaatattcgaatgccgaggtcggtcgcaacaatctggagattctcgccgct
gcgaccctggaagccagcctgttgcatccgcgccagccggcgccgaagcgcgaatatctc
accgcgatggaccggctctcggagctcgccttcaaggcctatcgcggcctggtctatgag
accgacggcttcgtcgactatttctgggcctcgaccgtcatcaacgagatcgcgaccttg
aacatcggcagccgtccggcgtcgcgcaagaagacccgcgcgatcgaggacctgcgcgcg
atcccctgggtgttctcctgggcgcaatgccggctgatgctgcccggctggtatggcttc
ggcagcgcggtggagacctggatcgccgagaacccggagcagggcatgccgttcctgcgc
gagctctatcaggaatggccgttcttccgcatgctcctgtccaatatggacatggtgctc
gccaagagttcgatcgcgatcgcctcgcgctatgccgaactggtgcctgatgaggcgttg
cgtgagaagatcttcggccgcatccgccgtgaatggcatcttgcgatcgagaccttgctc
gacatcatggggcaggagcgtctgttgcagggcaacccgctgctggagcgctcggtccgc
aaccgttttccctatctcgatccgctcaaccatgtgcaggtcgagcttttgaaggagcat
cgcgcgcagaacccggatgagcaggtgctgcgcgggatccagctgacgatcaacggcatc
tcggcgggtctcagaaatacgggatga

DBGET integrated database retrieval system