KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0044Help
Entry
HMPREF9228_0044   CDS       T01844                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxykinase (GTP)
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF9228_0044 (ppc)
  Energy metabolism
   00680 Methane metabolism
    HMPREF9228_0044 (ppc)
Enzymes [BR:bbv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HMPREF9228_0044 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(54044..56797)
Genome map
AA seq 917 aa AA seqDB search
MATPEEQITPADAAIVTTGTGRKGPEEHDLPQSLKDDMDLCLKILRDVLGEYNPELLSTF
DTVRNYSVEASAEHFAELEDPNPAQDGLKEAVNVIDNMTLHDAQLLARAFATYFHLANLS
EENYRVSVLHERENNVSGEQAVDPINELTVAYHQLINEMGPAKAKELLDQLEFHPVFTAH
PTEARRKAVEGKIRRISELLGEYKILGGSDKKECLRRLYNEIDALFRTSPIALKKPTPVE
EADTILDIFDNTLFHTIPKVYRRFDDWILGDQAGLVEPVCPAFFHPGSWIGSDRDGNPNV
TAKVSRAVARKFSDHVIAALEEATRTVGRNLTMEAETTPPSAELKNLWSHQKEMSERLTD
KAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCDDFLNDLKVVQRSLAEAGAKRSA
YGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALADIREHGLHGERGELQPMTHEVLDTF
RALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLED
LQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKW
AESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVLA
IRHVESVAAATLLQSAPSVEKRNTDMTKKYADMAAQLDEAAHNRFLDLLNTDGFAPWFSI
VTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGD
LETMRQAYEEWPLFSTFIDNIEMSIAKTDERIAKMYLALGDREDLNKKVLEEMELTRKWV
LDIVGDKWPLQHRHVLGQAIRIRSPYVDALSVTQVLALKSLRKKVDKEELSQSQQAGFIY
LILCTVSGVAAGLQNTG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaccagaagaacagatcactcctgctgacgccgccatcgtcactaccggaact
ggccgcaagggccccgaggagcatgatcttccccaaagcctcaaggacgacatggatctg
tgtttgaagatcctgcgtgacgtactgggcgaatacaaccccgaactgctctccacgttc
gacaccgtgcgtaattactcggtggaagccagcgctgaacacttcgccgagttggaggat
ccgaaccccgcacaggatggcctgaaagaggccgtgaacgtcatcgacaacatgacgcta
cacgatgcccagctgctggcccgcgcattcgccacgtacttccatctggcaaacctgtcc
gaggagaactaccgcgtttccgtgctccatgagcgcgagaacaacgtatccggcgagcag
gcggtcgatccgatcaacgagctcaccgtcgcctaccaccagctcatcaacgagatgggc
ccggccaaggccaaggagctgctcgaccagcttgagttccaccccgtcttcaccgcgcac
cccactgaagcacgccgcaaggcagtggaaggcaagatccgccgcatctccgaattgctc
ggggaatacaagattctcggcggctcggacaagaaggaatgcctgcgccgtctctacaac
gagatcgacgccctgttccgcacctctccaatcgcgctgaagaagccgaccccggttgag
gaagcggacacgattctcgacatcttcgacaacacgctgttccacaccatccccaaggtc
taccgtcgcttcgacgactggattctgggcgaccaggccgggctcgtcgaacctgtctgc
cccgcgttcttccacccgggcagctggattggctccgaccgtgacggtaacccgaacgtc
accgccaaggtgagccgcgctgtggcccgcaagttctccgatcacgtgatcgccgctctc
gaggaagccacccgtacagtgggccgcaacctcacgatggaggccgagaccacgccgccg
agcgccgagctcaagaacctgtggagccaccagaaggaaatgagcgaacgcctgaccgac
aaggccgccctgatctccaccaaggagatgcaccgcgcggtcatgctggtgatggccgat
cgtctgcattacaccattgagcgcgatgccgacctcatgtaccactcctgcgacgacttc
ctcaacgatctcaaggtggtgcagcgttcgctggccgaggccggcgccaagcgctccgct
tacggcccgctgcaggatctgatttggcagaccgagaccttcggcttccacatggtggag
atggagttccgtcagcactccgtggtgcacgcccgcgcccttgcggatatccgcgagcat
ggtctgcacggcgagcgcggcgaactgcagccgatgacgcacgaggtgctcgataccttc
cgtgctctcggtgccatccagaagcgcaacggcctcaaggccgcccgccgctacatcatc
tccttcaccaagagcgcccagaacatcaaggatgtctacgagctcaaccgcttggcattc
tcccacccggaggatgtgcccaccatcgacgtgatcccgctgttcgagcagcttgaggat
ttgcagaactcggtggatgtgctcgaagaaatgattaagatccccgaggttcaggctcgc
ctgaaggccaccggcaacaagctcgaggtcatgctcggctactccgattcctcgaaggac
gccggcccgacttccgccacgctggccctgcactccgctcaggagcgcatcgccaagtgg
gccgaatcgcacgacatcgatctgaccttgttccacggccgcggtggtgccgtcggtcgt
ggtggcggccctgccaaccgtgcggtgcttgcccagccggtcggttccgtcaagtgccgc
ttcaagctcaccgagcagggcgaggtcatcttcgcccgctacggcaacccggtgctggcc
atccgccacgtcgagtccgtggctgcggcaaccctgctgcagtccgcgccgagcgtggag
aagcgcaacaccgacatgaccaagaagtacgccgacatggctgctcagctcgacgaggcc
gcgcacaaccgcttcctcgacctgctgaacaccgatggcttcgccccgtggttctcgatc
gtcacgccgctgaccgaaatcggtctgctgccgattggctcccgcccggccaagcgcggc
cttggcgccaagtccctagacgatttgcgtacgattccgtggatcttctcctgggctcag
gcacgcatcaacctggccgcttggtacggcctcggtaccgcatgcgagaagttcggcgat
ctggagaccatgcgtcaggcctacgaggaatggccactgttctccacgttcatcgacaac
atcgagatgtccatcgccaagacggacgagcgcattgccaagatgtacctcgccctcggc
gaccgcgaggacctcaacaagaaggtgctcgaggagatggagctcacccgcaagtgggtt
ctggacatcgtgggtgacaagtggccgctgcagcaccgccacgtgctcggccaggccatc
cgcattcgttcgccgtatgtggacgcgctgtccgtcacccaggtgctggcgctcaagtcg
ctgcgcaagaaggtggacaaggaagagctctcgcaaagccagcaggcaggattcatctat
ctgatcctctgcaccgtttcaggtgttgctgccggcctgcagaacacgggctga

DBGET integrated database retrieval system