KEGG   Bordetella bronchiseptica S798: BBS798_2574Help
Entry
BBS798_2574       CDS       T03637                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbx  Bordetella bronchiseptica S798
Pathway
bbx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bbx00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BBS798_2574 (gst)
Enzymes [BR:bbx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BBS798_2574 (gst)
Transporters [BR:bbx02000]
 Other Transporters
  Pores ion channels [TC:1]
   BBS798_2574 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: BAO69299
LinkDB All DBs
Position
complement(2798426..2799049)
Genome map
AA seq 207 aa AA seqDB search
MSRWTFYTAPGTCALATHIALHEAGADFDLVKLDFGATQQQSPDYLRVNPKGRVPALATE
HGVLTENPALLAFIAQSFPQAQLAPLGDPFAFARMQELANYLASTAHVAHAHKRRGARWA
DDPAAHEAMRAKIPENMTAIAGYLESQIVGPWALGERFSVVDGYLYTVGSWMEGDSVDMT
RFPKLADYLARVGARPAVQRALAEMNG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctggaccttctataccgcccctggcacctgtgcgctggcgacgcacatcgcg
ctgcacgaagccggcgccgatttcgatctggtcaagctggatttcggcgccacgcagcag
caaagccccgactacctgcgcgtcaaccccaagggccgcgtgccggcgctggccaccgaa
catggcgtgctgaccgagaatcccgccctgctcgctttcatcgcgcagagctttccgcag
gcgcagctggcgccgctgggcgatccgttcgcgttcgcgcgcatgcaggaactggccaac
tacctggcctccaccgcgcacgtcgcgcacgcgcacaaacggcgcggcgcgcgctgggcc
gacgacccggccgcgcacgaggccatgcgcgccaagatccccgagaacatgacggccatc
gccggctacctggaatcgcagatcgtcggtccctgggcactgggcgagcgcttcagcgtg
gtcgacggctatctgtacaccgtcggcagctggatggaaggcgacagcgtcgacatgacg
cgctttcccaagctggccgactacctggcgcgcgtcggcgcgcggccggccgtgcagcgc
gcgctggccgagatgaacggctga

DBGET integrated database retrieval system