KEGG   Bordetella bronchiseptica S798: BBS798_2890Help
Entry
BBS798_2890       CDS       T03637                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bbx  Bordetella bronchiseptica S798
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBS798_2890
Enzymes [BR:bbx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BBS798_2890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3154924..3156528
Genome map
AA seq 534 aa AA seqDB search
MTAPTLAPIDPPARAQLLADLQGAPDWDVIVIGGGATGLGTAVDAAARGYRTLLVEAADF
AKGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLNRNAPHLVWPLGFVVPAYSLLDQ
PFYGVGLKMYDMLAGKLNLAPSRWLSRGETLRHAATVAERVNGRALRGGILYYDGQFDDA
RLAIALMRTLYDLGGVALNYARAVGLTRTDGRVDGVTVADALGELRVTLRAKCVVNATGV
WVDAVRRMDDPAAQTMVAPSQGVHLTLPRDFLPGEDAILIPKTDDGRVLFVVPWNGHTIV
GTTDTPRTDLPLDPQAGQNEIDFILATAARYLSRKPTRADVTSVWAGLRPLVKATGEAST
KSLSREHTIVVSKGGLVTVTGGKWTTYRKMAQDVVDTAIQHKLLAAAPCRTSELPLHGAP
TDGQPNGAPHGTPDSYYGTDLATLRALPGADRMLVKASALTEAHVRYAARHELARTVEDV
LARRNRALFLDAEAALLAAPEVARILAQELGHDEAWSRATLAEFEAVAAHYRLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccctaccctcgctcccatcgacccgcccgcgcgcgcgcaactgcttgccgac
ctgcaaggcgcccccgattgggatgtcatcgtcatcggcggcggcgccaccggcctgggc
accgccgtcgatgccgccgcgcgcggctaccgcaccctgctggtcgaggccgccgacttc
gccaagggcacctccagcaaggccaccaagctggtgcacggcggcgtgcgctacctggcg
cagggcaatatcagcctggtgcgcgaggccctgcacgaacgcggcctgctcaaccgcaac
gcgccgcacctggtgtggccgctgggcttcgtcgtgccggcctacagcctgctggaccag
ccgttctacggcgtcggcctgaagatgtacgacatgctggccggcaagctgaacctggcg
cccagccgctggctgtcgcgcggcgaaacgctgcgccacgccgccaccgtggccgagcgc
gtcaatggacgagccttgcgcggcggcatcctgtactacgacggccagttcgacgacgcg
cgcctggccatcgccctgatgcgcaccctgtacgacctgggcggcgtggcgctgaactat
gcgcgcgcggtcggcctgacgcgcacggacggccgcgtcgacggcgtgacggtggccgac
gcgctgggcgagctgcgcgtgacgctgcgcgccaaatgcgtggtcaacgccaccggcgtg
tgggtcgacgcggtgcgccgcatggacgaccccgccgcgcagaccatggtggcgcccagc
cagggcgtgcacctgacgctgccgcgcgacttcctgcccggcgaagacgccattctcata
cccaagaccgacgacggccgagtgctgttcgtggtgccctggaacggccacaccatcgtc
ggcaccaccgacacgccacgcaccgacctgccgctcgatccgcaggccggccagaacgaa
atcgacttcatccttgccaccgcggcgcgctacctgagccgcaagcccacccgcgccgac
gtgaccagcgtgtgggccggcctgcgcccgctggtcaaggccaccggcgaagcctcgacc
aagtcgctgtcgcgcgaacacaccatcgtggtctccaagggcgggctggtcacggtcacc
ggcggcaaatggaccacctaccgcaagatggcccaggatgtggtcgacaccgccatccag
cacaagctgctggccgcggcgccatgccgcacgtccgagctgccgctgcatggcgcgccg
accgacgggcagcccaacggcgcgccccacggcacgcccgacagctactacggcaccgac
ctggcgacgctgcgcgcgctgcctggcgccgaccgcatgctggtcaaggccagcgccctg
accgaggcgcacgtgcgctatgccgcccgccacgaactcgcgcgcaccgtggaggacgtg
ctggcccgccgcaatcgcgccctgttcctggacgccgaggccgccctgctggccgcgccc
gaagtggcccgcatcctggcgcaggaactcggccacgacgaagcctggagccgcgccacg
ctggccgagttcgaggccgtggccgcgcactaccggctggcctga

DBGET integrated database retrieval system