KEGG   Bacillus bombysepticus: CY96_09415Help
Entry
CY96_09415        CDS       T03597                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bby  Bacillus bombysepticus
Pathway
bby00473  D-Alanine metabolism
bby01100  Metabolic pathways
bby01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bby00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CY96_09415
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CY96_09415
Enzymes [BR:bby01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CY96_09415
Peptidoglycan biosynthesis and degradation proteins [BR:bby01011]
 Precursor biosynthesis
  Racemase
   CY96_09415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHX18208
UniProt: A0A023P684
LinkDB All DBs
Position
1821733..1822959
Genome map
AA seq 408 aa AA seqDB search
MKREIEWNAIIELGVRPMSLKYGRDTIVEIDLNAVKHNVKEFKKHVNDEEIKMMAAVKAN
GYGHGAVEVAKAAIEAGIHQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDV
MMTVYRVEDLHGINEIANRLQKKVQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYVEVV
GIFTHYSTADEIDKSYTNMQTSLFEKAVNTAKELGIQIPYIHSSNSAGSMELSNTFQNMV
RVGIGVYGMYPSKEVDHSVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGYALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQG
EENIAVEEIADMLGTINYEVTCMLDRRIPRVYKENDETTAIVNILRKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaaatagaatggaatgcaattattgagttaggagttagaccaatgagtttg
aaatatggaagagatacaattgtagaaattgacttaaatgctgtaaaacataatgtaaaa
gaatttaaaaaacatgtaaatgatgaagaaattaagatgatggctgctgtaaaagcgaat
gggtatggccatggggcagttgaagttgccaaagctgcaattgaagctgggatacatcaa
cttgcagttgcatttgtagatgaagcaatagaattaagagaagcaggaattactgtgccg
attttaattttaggatacacaccagtagcggctgtagaagatgtaattcaatatgacgtt
atgatgactgtttatagagtagaagatttacatggtataaatgaaattgcaaaccgtctt
caaaagaaagtacaaattcaagtgaaaattgatacaggaatgagtcgtatcggtttacaa
gaagaagaagttaaaccatttttagaagaattaaaccgtatggagtatgtagaggtagta
gggatatttacgcattactctacggcagatgaaatcgataaatcatatacgaatatgcaa
acaagtttatttgaaaaggctgttaatacagcgaaagaattaggaattcaaataccatat
attcatagttcaaatagtgcgggatcaatggaattaagtaacacatttcaaaatatggta
cgcgttggaataggagtgtacggtatgtatccatcaaaagaagtggatcattcagtcgtt
tctttacagcctgcgttgtcgttaaaatcaaaagtagctcatattaaacatgcgaagaag
aatcgtggtgtaagttatgggaatacgtatgtaacaactggtgaagaatggattgcgact
gtaccaattggttatgctgatggttataatcgtcaattatctaataaaggctatgcgtta
attaacggggttcgagtacctgttattggccgtgtttgtatggatcagttaatgttggat
gtttcaaaagcgatgccagtacaagtaggagacgaagtagtattctacggtaaacaaggt
gaagaaaatatcgcagtagaagaaatagcggatatgttaggcacaataaactatgaagtt
acatgtatgctagatagaagaattccgcgtgtctataaagaaaatgacgaaacaactgca
attgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system