KEGG   Bacillus cereus ATCC 10987: BCE_2163Help
Entry
BCE_2163          CDS       T00162                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCE_2163 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BCE_2163 (alr)
Enzymes [BR:bca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BCE_2163 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bca01011]
 Precursor biosynthesis
  Racemase
   BCE_2163 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2074539..2075714
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKANGYGHGAVEVAKAAIEAG
INQLAVAFVDEAIELREAGINVPILILGYTSVAAAEEAIQYDVMMTVYRSEDLQGINEIA
NRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVVGMFTHYSTADEIDKSYT
NMQTSLFEKAVNAAKELGIHIPYIHSSNSAGSMELSNTFQNMVRVGIGIYGMYPSKEVDH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
YALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENNETTAIVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacat
aatgtaaaagaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgta
aaagcaaatgggtatggccacggagcagttgaagttgcgaaagctgctattgaagcggga
ataaaccagcttgcagttgcatttgtagatgaagcgatagagttaagagaagcaggaatt
aacgtgccgattttaattttaggctatacgtcagtagcggctgcggaagaagcaattcaa
tatgacgttatgatgactgtttatagaagtgaagatttacaaggtataaatgaaatcgca
aaccgtcttcaaaagaaagcgcaaattcaagtgaaaattgatacagggatgagtcgtatc
ggtttacaagaagaagaggttaaaccatttttagaagaattaaaacgtatggagtatgtg
gaggtagtaggaatgtttacacattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgagaaagctgtcaatgcagcaaaagaattaggaattcat
attccgtatattcatagttcaaatagtgcaggttcaatggaacttagcaatacatttcaa
aatatggttcgtgtaggtatcggaatttatggaatgtatccttcaaaagaggtagatcat
tcagttgtttctctacagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcat
gcgaagaaaaatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatgg
attgccactgtaccgattggttatgctgatggctataaccgtcagttatctaataaaggg
tatgcattaataaatggagttcgagtacctgttattggtcgtgtttgtatggatcagctt
atgttagacgtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggt
aaacaaggcgaagaaaacatcgcagtagaagaaatagcggatatgttaggtacaattaac
tatgaagttacatgtatgttagacagaagaatcccgcgagtttataaagaaaataatgaa
acgactgctattgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system