KEGG   Bacteroides caccae: CGC64_11165Help
Entry
CGC64_11165       CDS       T05064                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
bcac  Bacteroides caccae
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bcac00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CGC64_11165
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CGC64_11165
Enzymes [BR:bcac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CGC64_11165
Bacterial toxins [BR:bcac02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CGC64_11165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2766878..2768518
Genome map
AA seq 546 aa AA seqDB search
MKRNLLLLLSILFLSVCGTLQAVTSDTVFVRETQIPILIERQDNVLFMLRLNAKESRSLD
EVVLNFGKDVNMADIQSVKLYYSGTEARQNYGKKFFTPVSYISSHTPGKTLAANPSYSIN
KSQVNNPGRKVILNANQKLFPGINYFWISLQMKPGASLLDKVSAKIVTVKVDNKEALMHT
VSPENIAHRVGVGVRHAGDDGSAAFRIPGLATTNKGTLLGVYDVRYNSSVDLQEHVDVGL
SRSVDGGKTWEKMRLPLAFGETGGLPAAQNGVGDPSILVDTKTNTTWVVAAWTHGMGNQR
AWWSSYPGMDMNHTAQLVLSKSTDDGKTWSEPINITDQVKDPSWYFLLQGPGRGITMQDG
TLVFPIQFIDSTRVPNAGIMYSKDRGETWKIHNYARTNTTEAQVAEVEPGVLMLNMRDNR
GGSRAVATTKDLGKTWTEHPSSRKALQEPVCMASLISVKAADNTLNKDILLFSNPNTVKG
RHHITIKASLDGGITWLPEHQVMLDEGDGWGYSCLTMIDKETVGILYESSVAHMTFQAIR
LRDIIQ
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaacctacttttattattatctatcctttttttatctgtctgtgggactttg
caggctgttacatcggatactgtatttgtgcgtgaaactcagattccaattttgattgaa
cgacaggataacgtgttgtttatgttgcgtttgaatgcaaaagagagtcgtagtttggat
gaagtagttttgaattttggcaaagatgtgaatatggcggatatacagtccgttaagtta
tattatagtggtacggaggccagacaaaactatggtaagaaattctttactcccgtatct
tatatttccagccatacgccggggaagacattggctgcgaatccttcttattcaattaat
aaatcacaggtaaataatcccgggcggaaagtgatactgaatgctaatcagaaacttttt
cccggaatcaattatttctggatcagtctgcaaatgaaaccgggcgcctctttgctggat
aaagtgtcagctaagattgttactgttaaggttgataataaagaagcacttatgcatacg
gtttcgccggagaatatagctcatagggtaggagtaggggtacgccatgccggtgacgat
ggttcggctgccttccgtattccgggattggcaactactaataaaggaacattgctggga
gtttatgatgtacgttataatagcagtgttgatttgcaggaacatgtggacgtcggtttg
agccgtagtgtagacggtggtaaaacatgggagaagatgcgtttacctttagcttttggt
gaaactggcggtttgcctgctgcgcagaacggtgttggcgacccttcgatcttagtggat
accaagaccaacacaacatgggtggtggcggcttggacacatggaatgggtaatcagcgt
gcttggtggagttcttatccgggaatggatatgaatcatacggcccagttggtattgtca
aagagtacggacgatggtaaaacgtggtcggagcctattaatataacagatcaggtgaaa
gatccatcctggtatttccttttgcaaggaccgggacgaggtatcaccatgcaagacggc
acattggtattcccgattcagtttatcgattctacccgtgttccgaatgcgggaattatg
tatagcaaagaccgtggcgaaacatggaaaatccataactatgcacgcaccaatacaaca
gaagctcaggtagcggaagtggagcctggcgtactgatgttaaatatgagagataaccgt
ggaggcagtcgtgctgtcgctactaccaaggatctcggtaagacttggacagaacatcct
tcttcccgtaaagctttacaggaaccggtgtgtatggcaagtttaatcagcgtgaaagcg
gcagacaacacattaaataaggatattcttttattctccaatccgaatacggtaaaaggt
cgtcatcatatcacgatcaaggccagtctggatggaggtatcacctggctacccgaacat
caagtgatgctggatgaaggtgacggttggggatattcttgtttgacaatgattgataaa
gagacagtcggcatattatatgaaagcagtgtcgctcatatgacttttcaggcaatccgg
ctgagagatataatacaatag

DBGET integrated database retrieval system