KEGG   Paraburkholderia caribensis: K788_0008258Help
Entry
K788_0008258      CDS       T04141                                 

Definition
(GenBank) Aldehyde dehydrogenase
Organism
bcai  Paraburkholderia caribensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(943045..944514)
Genome map
AA seq 489 aa AA seqDB search
MTEYSPALSSNVRSRFFIDGEWVLSHSDARHVLISPATEDPFMSVPLADSVDVERAIAAA
RRAFDKGPWPKLSGAERSVYLKRLTEEIRQRLPLLAQLWTDQVGAPITFASGLLPTGITR
FEFFASLAETFEFEDARPTRHGHARVRREPVGVAALIAPWNATFPIVSHKIAAALAAGCT
VVVKSPPESPLDALIIAECAAAAGLPPGVLNVVTAGRDEGAQLVQSRDVDKISFTGSVAT
GQWIARAAVDRLARVTLELGGKSAAILLDDVDLPSALAALTPFTMPFSGQICFAQTRILA
PRARHDEVVSAYAEIISKLKLGDPREADTRIGPVLNAVQRERVRGYIEQGIGEGAQMVLG
GTGNGGFAKGYFVEPTVFAHVTPDMTIAQQEIFGPVVSILPYDDIDDAVRIANDTPYGLS
GSVYSSDVERAYALACRIQAGHIGINGIELAANVPFGGYKLSGVGREGGREGLEAYLETK
AVFMPTAAG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtactccccagcactttcgtcgaatgtccgcagtcgctttttcattgatggc
gaatgggtattgagccattccgatgcgcgccatgtgctgatttctcctgcgacggaagat
ccgttcatgtccgttccgctcgcggattccgtggacgtcgagcgcgcgatcgcggcggcg
cgccgggcattcgacaaggggccgtggccgaagctgtcgggcgctgagcgaagtgtttat
ctgaagcggctgacggaagaaatccgccagcgcttgcccttgctcgcgcaactgtggacc
gatcaggtcggcgcgccgattacgttcgcaagcggcctgctgcccacgggcatcacacgc
ttcgaattctttgcgtcgctcgcggagacgttcgaattcgaagacgcgcgaccgacacgg
cacggccacgcgcgcgtgcggcgcgaacccgtcggcgtagccgcgttgattgcgccgtgg
aatgcaaccttcccgatcgtgtcgcacaagatcgcggcggcgctggcggcggggtgcacg
gtcgtcgtcaaatcgccgccggagagtccgctcgatgcgctgatcatcgcggaatgcgcg
gcggcggcgggcctgccgccgggcgtgctcaatgtcgtcacggcgggccgcgacgagggc
gcgcaactggtgcaatcgcgcgacgtcgacaagatcagcttcacgggcagcgtggcaacg
gggcaatggatcgcgcgtgcggccgtcgacaggctggcgcgcgtgacgctggaactcggc
gggaaatcagcggcgattctgctcgacgacgtcgatctgccttcggcgctggccgcgctg
acgccgttcacgatgccgttttccggccagatctgcttcgcacagacgcgcattcttgcg
cccagggcgcggcatgacgaggtcgtgagcgcgtacgctgagatcatttcgaagctgaag
ctcggcgacccgcgcgaggccgatacgcgtatcgggccggtattgaacgcagtgcagcgc
gagcgcgtgcgcggctatatcgagcagggcatcggcgaaggcgcgcagatggtgttgggc
ggaacgggcaatggcggcttcgcgaagggctacttcgtcgagcctacggtattcgctcat
gtcacgccggacatgacgattgcgcagcaggagatcttcggccccgtcgtgtcgattctg
ccgtacgacgacatcgacgacgccgtgcgtatcgcaaacgacacgccgtatggtctgagc
ggctcggtgtatagcagcgatgtggagcgggcttacgcgctcgcgtgccgcattcaggca
ggccatatcggcattaacggcatcgagctggcggccaatgtgccgttcggcggttacaag
ttatcaggagtgggccgcgaaggcggccgcgagggactggaggcgtacctcgaaaccaag
gcagtgttcatgccgacggcggctggatga

DBGET integrated database retrieval system