KEGG   Bifidobacterium catenulatum: BBCT_1310Help
Entry
BBCT_1310         CDS       T03931                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
bcat  Bifidobacterium catenulatum
Pathway
bcat00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bcat00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BBCT_1310
Enzymes [BR:bcat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BBCT_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Cellulase DUF4434 DUF4350
Motif
Other DBs
NCBI-ProteinID: BAR02278
UniProt: B6XT34
LinkDB All DBs
Position
complement(1554429..1556555)
Genome map
AA seq 708 aa AA seqDB search
MGRYEADHILFGAAYYDEYLMMKGIDRVDEDMRMMKEAGLNVIRIAESTWSTCEPQPGAF
DFTYVDRALDAAQRAGIDVIVGTPTYAVPSWLVKIDPSVLAVTPNGEGKYGARQIMDIVN
ATYRFYGERVIRKLISHVADHPAVIGYQVDNETKYYDSVSNDMQRLFVKYLHEKFNGDLN
ELNHHFGLDYWSNRIDSWEDFPNVTATINESLGGEFDKFRRDQVRAFLQWQSDIVREYAH
DDQFITHNFDFEWRGYSFGVQPAVDHFKAATAVDITGVDIYHPTEDDLTGKEIAFGGDMT
RSTKNGQNYLVLETEAQGQHGWVPFPGQLRLQAYSHLASGADMVEYWHWHSIHNSFETYW
KGLLSHDLEPNPTYREAGVFGREIAKPEVGERLVHLKKHNKVAIMVSNESLTALDWFLIE
AGFPFGGTLKYNDVVRNVYDALFELNVECDFVPSDAPAERLARYEMIVTPALYCASQETT
DRLRTFVENGGHLVSTMRSFVTDDEVTVWHDRAPHNLTDVFGMTYNQFTRPNGHVSVEFA
GALAETASTDAQSLIELLNADADTEVLASYGHYAWKDYAAVTRHAFGKGDAEWVATLLDA
DSIRAVMREAVEHAGVEGAGTALAGQVAVRQGVNARGENVTYLLNYSADEVTVASPIEGE
VVVAPVVIATDGSIDEVANAEVVLKEGAAVKQGDPLTIGRWNVAVIAG
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgttacgaggcagatcacattcttttcggtgccgcatattacgacgaatatctc
atgatgaaaggcatcgaccgtgtcgatgaagacatgaggatgatgaaggaagcgggactg
aacgttatccgtattgccgaatccacatggagcacctgcgaaccgcagccgggtgcgttc
gacttcacctatgtggatcgtgctctcgacgcggcacagcgtgccggtatcgatgtcatc
gtcggcactccaacctacgcggtgccgagctggctcgtcaagatcgatccgagcgtgctc
gcggtcaccccgaacggcgaaggcaagtacggcgcccgccagatcatggacatcgtcaac
gccacctaccgtttctacggtgagcgcgtgatccgcaagctgatctcccacgttgccgac
catccggcggtgattggctaccaagtcgataatgaaaccaagtactacgattccgtgtcc
aacgacatgcagcgtctgttcgtcaagtatctgcatgagaagttcaatggcgatctgaat
gagctgaaccaccacttcggcctcgactactggtccaaccgcatcgactcctgggaggac
ttcccgaacgtgaccgccaccatcaacgagtccctgggcggcgaatttgacaaattccgt
cgcgatcaggtgcgtgccttcctgcagtggcagtctgatattgtgcgcgaatacgcccac
gatgaccagttcatcacccacaatttcgatttcgaatggcgtggctattccttcggtgtg
cagccggccgtcgaccacttcaaggccgcgaccgcagtggacatcaccggcgtggacatc
taccacccgaccgaagacgacctgaccggcaaggagatcgccttcggcggcgacatgacc
cgctccaccaagaacggccagaactacctggtgctcgaaaccgaggcccaaggccagcac
ggctgggtgccattccctggccagttgcgcctgcaggcctactcccacctcgcctccggc
gccgacatggtggaatactggcattggcactccatccataattcctttgaaacatattgg
aagggcctgctgagccacgacctcgaaccgaaccccacgtaccgcgaagccggcgtattc
ggtcgcgagatcgccaaaccggaagtgggggagcggctcgtccacctgaagaagcacaac
aaagtagccatcatggtcagcaacgaatcgctgaccgcgctcgactggttcctcatcgaa
gccggcttcccattcggcggcaccctcaaatacaacgacgtggtgcgcaatgtctacgac
gcgctgttcgagctcaacgtcgaatgcgatttcgtgccgtccgatgctccggccgaacgt
ctcgccagatacgagatgatcgtgaccccggcgctctactgcgcatctcaggaaactacg
gatcgcctgcgtacgttcgttgaaaacggcggacacctcgtctccaccatgcgctccttc
gtgaccgacgacgaggtgaccgtatggcacgaccgcgcgccgcacaacctcaccgacgtg
ttcggcatgacgtacaaccagttcacccgcccaaacggccacgtttccgtggaattcgca
ggtgcgctcgccgaaaccgcgtccaccgatgctcagtcgctgatcgaactgttgaacgcc
gacgccgatactgaggtgctcgcatcctatggacactacgcttggaaggattacgccgca
gtcacccgtcacgcattcggcaagggcgatgccgagtgggtcgccacactgcttgacgcc
gattccattcgtgcggttatgcgagaggccgtggagcatgccggcgtcgagggcgctgga
accgcgctcgcgggacaggtcgcggttcgccagggtgtgaatgcccgcggcgagaacgtg
acgtatctgctcaactattccgccgacgaagttactgttgcaagcccgattgagggtgaa
gtagtggtcgctccggtcgtcatcgccaccgacggcagtattgatgaggttgcaaatgct
gaagtcgtgctgaaggaaggtgcagccgttaagcagggtgatccgttgacgatcggccgc
tggaatgttgcggtgatcgccggctga

DBGET integrated database retrieval system