KEGG   Bacillus cereus ATCC 14579: BC2063Help
Entry
BC2063            CDS       T00127                                 

Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00473  D-Alanine metabolism
bce01100  Metabolic pathways
bce01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BC2063
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BC2063
Enzymes [BR:bce01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BC2063
Peptidoglycan biosynthesis and degradation proteins [BR:bce01011]
 Precursor biosynthesis
  Racemase
   BC2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 1204412
NCBI-ProteinID: NP_831831
UniProt: Q81EB9
LinkDB All DBs
Position
2004325..2005551
Genome map
AA seq 408 aa AA seqDB search
MKREIEWNAIIELGVRPMSLKYGRDTIVEIDLNAVKHNVKEFKKHVNDEEIKMMAAVKAN
GYGHGAVEVAKAAIEAGIHQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDV
MMTVYRVEDLHGINEIANRLQKKVQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYVEVV
GIFTHYSTADEIDKSYTNMQTSLFEKAVNTAKELGIQIPYIHSSNSAGSMELSNTFQNMV
RVGIGVYGMYPSKEVDHSVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGYALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQG
EENIAVEEIADMLGTINYEVTCMLDRRIPRVYKENDETTAVVNILRKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaaatagaatggaatgcaattattgagttaggagttagaccaatgagtttg
aaatatggaagagatacaattgtagaaattgacttaaatgctgtaaaacataatgtaaaa
gaatttaaaaaacatgtaaatgatgaagaaattaagatgatggctgctgtaaaagcgaat
gggtatggccatggggcagttgaagttgccaaagctgcaattgaagcaggaatacatcaa
cttgcagttgcatttgtagatgaagcaatagaattaagagaagcaggaattactgtgccg
attttaattttaggatacacaccagtagcggctgtagaagatgtaattcaatatgacgtt
atgatgactgtttatagagtagaagatttacatggtataaatgaaattgcaaaccgtctt
caaaagaaagtacaaattcaagtgaaaattgatacaggaatgagtcgtatcggtttacaa
gaagaagaagttaaaccatttttagaagaattaaaccgtatggagtatgtagaggtagta
gggatatttacgcattactctacggcagatgaaatcgataaatcatatacgaatatgcaa
acaagtttatttgaaaaagctgttaatacagcgaaagaattaggaattcaaataccatat
attcatagttcaaatagtgcgggatcaatggaattaagtaacacatttcaaaatatggta
cgcgttggaataggagtgtacggtatgtatccgtcaaaagaagtggatcattcagtcgtt
tctttacagcctgcgttgtcgttaaaatcaaaagtagctcatattaaacatgcgaagaag
aatcgtggtgtaagttatgggaatacgtatgtaacaactggtgaagaatggattgcgact
gtaccaattggttatgctgatggttataatcgtcaattatctaataaaggctatgcgtta
attaacggggttcgagtacctgttattggccgtgtttgtatggaccagttaatgttggat
gtttcaaaagcgatgccagtacaagtaggagacgaagtagtattctacggtaaacaaggt
gaagaaaatatcgcagtagaagaaatagcggatatgttaggtacaataaactatgaagtt
acatgtatgctagatagaagaattccgcgtgtctataaagaaaatgacgaaacaactgca
gttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system