KEGG   Bacillus cereus ATCC 14579: BC2220Help
Entry
BC2220            CDS       T00127                                 

Gene name
adhA, adhP
Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC2220 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    BC2220 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC2220 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC2220 (adhA)
   00626 Naphthalene degradation
    BC2220 (adhA)
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BC2220 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2164344..2165381
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVIEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVTKIADDVTSLKIGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPSQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIVQEKFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKKHNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtggttaataaaaacagcaaagcaaacatcgaagtgattgaaaaagaa
ttacgtccgttacactcaggtgaagcgttagtagatgtagagtattgtggagtttgccac
actgatttacacgttgcgaatcatgattttggtaacactgatggccgtattcttggtcat
gagggtgtaggtattgttacgaaaatagctgatgatgttacttcactaaagataggtgac
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtaactggt
agagaaacattttgccgtgaagttaaaaacgctggttattcagtggatggtggtatggct
gaacaatgtatcgttacagctgattatgcggtaaaagtaccagaaggattagatcctgct
caagcatcatcaattacttgtgctggtgtaactacatataaagctattaaagtatcagat
attaaacctagtcaacctattgtaatctatggctgcggtggattaggtaacttagctatc
caatatgctaaaaatgtatttggtgcaaaggtaatcgcagtagacattaatgacgataaa
ttagccttagcgaaagaagttggtgctgatatgactatcaatccaatttctcaaggtcct
gctgataaaattgtgcaagagaagtttggtggcgcttatgctgcggtagtaacagcagtc
tctaaagtagcctttaactcagcagttgatgcagtacgtgcttgcggtaaagtagttgca
gtagggctaccagtagaaacaatggacttaaacatcccacgacttgtactggatggaatt
gaagtagttggttctctagttggtactcgtaaagatttggaagaggcgtttatgtttggg
gcagaaggaaaagtagtgccggttgttcaaacttgttcgctagataaagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaagggcgtatggtaattgattttaaaaaacat
aattgtgattgcaaataa

DBGET integrated database retrieval system