KEGG   Bacillus cereus ATCC 14579: BC3323Help
Entry
BC3323            CDS       T00127                                 

Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:bce01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bce01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bce00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bce00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bce00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
LinkDB All DBs
Position
complement(3287414..3288484)
Genome map
AA seq 356 aa AA seqDB search
MVTKMTIDRICTIGPASNNKETLAQLIKNGMKIVRLNLSHGTHESHKDIIRLVKSLDDSI
KFLGDVQGPKIRLGEVKGEQITLQAGDSFILHTQPVTGSNTEASVDYEGIANDVKVGSRI
LINDGEVELIVEKISTDKIETKVKTGGNISSHKGVNLPDAAVRLPAITEKDKKDIQFLLE
ENVDFIACSFVRKPSHIKEIRDFIQQYKETSPNVIAKIETMEAIENFQDICKEADGIMIA
RGDLGVELPYQCIPLLQKMMIQECNRTNTYVITATQMLQSMVDHSIPTRAEVTDVFQAVL
DGTNAVMLSAESASGEHPIESVRTLRLVSEFAEHVKKDGPFAMKDVLQLLRESLDE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggtgacaaaaatgacaatcgatcgaatttgtacaattggacccgcaagtaataataaa
gaaacgttagcacagttaataaagaatggtatgaaaattgttcgactgaatttatcgcat
ggcacgcatgaaagtcataaagacatcattcgtttagtgaaatcattagatgactctatt
aaatttttgggtgatgtacaaggtcctaaaataagattaggtgaagtgaagggagagcaa
attacacttcaggcaggagattcttttattttacatacacaaccagttacagggagtaat
acagaagcaagcgttgattatgaaggaattgcgaatgatgtgaaagtaggcagtagaatt
ttaattaatgatggagaagttgaattaattgttgaaaagataagtacggacaaaatagaa
acgaaggtaaaaacaggtggcaatatctcatctcataaaggagttaatttaccagatgcg
gctgttcgtttaccagctattacagagaaagataaaaaagatattcagtttcttttagaa
gagaatgttgattttatcgcgtgttctttcgtaagaaaacctagtcatataaaagaaata
cgagattttatacaacagtataaagaaacgtcacctaatgtaattgcaaaaatagaaacg
atggaagcaatcgagaattttcaagatatatgtaaagaagcagatggaattatgattgca
aggggcgatttaggagtagagttaccgtatcaatgcattccgcttttacagaaaatgatg
attcaggaatgtaatcgaacgaatacatatgtcattacagcaacacaaatgcttcaatct
atggtagatcattctattccaacaagggcagaggtgactgatgtgtttcaagctgtactg
gacgggacgaatgcagttatgctttcagctgaaagtgcatcaggagagcatccaatcgaa
agtgtgagaacattacgtctcgtttcagaatttgcggaacatgttaaaaaagatggacct
tttgcgatgaaagatgtactgcaattactgcgtgagtctctggatgagtaa

DBGET integrated database retrieval system