KEGG   Burkholderia cepacia DDS 7H-2: DM42_6713Help
Entry
DM42_6713         CDS       T03302                                 

Definition
(GenBank) AMP-binding enzyme family protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:complement(354418..356181)
Genome map
AA seq 587 aa AA seqDB search
MTKCASTIHRLIESLEDIAGAMHRMTFVDDAGHEAGITYRHFAEAVFRQAGALRELGVRE
NDLVMLALPASVEHAVAMMACVMTGALPCTVPVPARRTAAGRQVADVAYELYRPRLVIAA
DAQAAAWRDDAFPAAATRVVDLATLSSAADAGARALISSKSGRDPHHVQLTSGSTSYPKA
AVLSHENVIANVLGIGGSVRFDIAAGDGTASWLPLYHDMGLLTLLSNLHYRAPLLMMQPN
SFIRNPLGWLKRIASARATTTSVPTFALRYCVRRFNAAAMDGVDLSACRNIFIGGERVDD
ATLRDFAATFAPYGLAASALQPCYGMAESTLAVSMHRAWHEGAVDGAPYVIADTLDRRAL
IERRDAQPAAANDGQDTETETVLAMGTPIDGMAFRILDDGDHALANRAVGEVAIRGTSVM
LGYLNPDDGTIAAPLTADGWFRTGDIGYVADGQLHILGRKKEVIIIRGSNYFPHEIEEAL
ASHSALRKSTCIAFGLPDPETGTERLVVAIEARPVDATPQTRTECQQLLASRIGFAAQDL
CFVEPGSLPRTTSGKLQRLKCRDLYANGALPVIPASAAVEAGQGAFA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaagtgcgcttccaccattcaccgcctgatcgaatcgctcgaggacatcgcgggc
gccatgcatcgcatgacgttcgtcgacgacgcgggccatgaagcgggcatcacgtaccgg
cacttcgcggaagcggtgtttcgccaggctggcgcactgcgcgagctcggggtgcgcgag
aacgacctggtgatgctcgcgctgccggcgtcggtcgagcatgcggtcgcgatgatggcg
tgcgtgatgacgggcgcgctcccgtgcaccgtgcccgttcccgcgcggcgtaccgcggcc
gggcggcaggtggcggacgtcgcgtacgagctgtaccggccgcgcctcgtcatcgccgcc
gacgcgcaggccgcggcctggcgcgacgacgcgtttcccgcggccgccacgcgcgtcgtc
gatctcgcgacgctgtcgagcgcggcggatgccggcgcgcgcgcgctgatcagttcgaag
agcggccgcgatccgcatcatgtgcagctcacgtcgggttcgacgtcgtatccgaaagcc
gcggtgctcagtcacgagaacgtgatcgcgaacgtgctcggcatcggcggatcggtgcgc
ttcgacatcgcggccggcgacggcaccgcgtcgtggctgccgctctatcacgacatgggg
ctgctcacgctgctgtcgaacctgcattaccgcgcgccgttgctgatgatgcagccgaac
agcttcatccggaatccgctcggctggctcaagcgcatcgcgtcggcgcgcgcgacgacg
acgtcggtgccgaccttcgcgctgcgctactgcgtgcgccgcttcaatgccgccgcgatg
gatggcgtcgacctgtccgcgtgccgcaacatcttcatcggcggcgaacgcgtcgacgac
gcgacgctgcgcgatttcgccgcgacgttcgcgccgtacggcctcgcggcgtcggcgctg
caaccgtgctacgggatggccgaatcgacgctcgcggtatcgatgcatcgtgcttggcac
gaaggcgcggtcgacggcgcgccgtacgtgatcgccgatacgctcgaccggcgcgcgctg
atcgagcgccgcgacgcgcagccggccgccgcgaacgatggccaggacacggagaccgaa
acggtgctcgcgatgggcacgccgatcgacgggatggcgttccgcatcctcgacgacggc
gaccacgcgctggccaatcgcgcggtcggcgaagtcgcgatccgcggcacgtcggtgatg
ctcggctacctgaaccccgacgacggcacgatcgccgcgccgctgacggccgacggctgg
ttccgcaccggcgacatcggctacgtcgcggacggccagttgcatatcctcggccgcaag
aaggaagtcatcatcattcgcggcagcaactatttcccgcacgagatcgaggaagctttg
gcctcgcacagcgcgctgcgcaagagcacctgcatcgcgttcggcctgcccgatcccgaa
accggcaccgagcggctggtcgtcgcgatcgaggcgcggccggtcgacgcgacgccgcaa
acgcgcaccgagtgccagcaactgctcgcgtcgcgcatcggcttcgccgcgcaggatctg
tgtttcgtcgagcccggctcgctgccgcgcacgacgagcggcaagctgcagcgcctgaag
tgccgcgatctctatgcgaacggcgcgttgccggtgatcccggcatcggccgccgtcgaa
gcgggccagggagcgttcgcatga

DBGET integrated database retrieval system