KEGG   Brucella ceti TE28753-12: V568_100880Help
Entry
V568_100880       CDS       T02935                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bcee  Brucella ceti TE28753-12
Pathway
bcee00730  Thiamine metabolism
bcee00790  Folate biosynthesis
bcee01100  Metabolic pathways
bcee02020  Two-component system
Module
bcee_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcee00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    V568_100880
   00790 Folate biosynthesis
    V568_100880
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    V568_100880
Enzymes [BR:bcee01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     V568_100880
Exosome [BR:bcee04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   V568_100880
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bcee00537]
 Enzymes
  V568_100880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase DUF5300
Motif
Other DBs
NCBI-ProteinID: AHB01890
LinkDB All DBs
Position
1:complement(810278..811723)
Genome map
AA seq 481 aa AA seqDB search
MPRKFTRPLLASAAIIVTFCAPASTVMAQSETAAPLFQRSAKGDLSAAGGARRLDGDITA
AFRDQIRKGPARNVILLIGDGMGDSEITVARNYAVGAGNHFKGIDALPVTGQYTHYSLDK
ESGKPNYVTDSAASGTAWATGVKTYNGAIGVDIHGKPHKTLIELAKEKGLGTGNVSTAEL
QDATPAVQVAHVTHRKCYDPTSTAEKCKDNALENGGPGSISEQLLNTRPDVTLGGGAKYF
EDKARAGTWKGQTLSAQAEARGYQLVRNADALSKVETANQDKPVLGLFSPGNMPVRWKGP
QAAHHGNLDREPVKCKVNEKRTADIPTLAQMTEKAIDLLKTNEKGFFLQVEGASIDKQDH
AANPCGQIGETVDLDEAVQAALDFARKDGNTLVIVTADHAHASQIIDPDAKAPGLSQALK
TEDGAIMGVTYGNSDEADDQGHTGAQLRIAAFGPGAANFTGLTDQTDMFYTIRDALQLQA
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggaaattcacccggccacttctggcaagcgctgcaattattgtcaccttttgc
gcacccgcaagcaccgtgatggcccagtctgaaactgcggctccactcttccagcgcagc
gcaaaaggcgacctgtcggcagcaggcggcgcacgccgccttgatggtgatattaccgca
gcttttcgcgatcagatcaggaaggggcctgccagaaacgtcatcctgctgatcggagac
ggcatgggcgattccgagatcacggttgcgcgcaattatgcagtcggcgcaggcaatcat
ttcaagggcatcgatgcccttcccgttaccggccagtacacccattattcgctcgacaag
gaaagcggcaagccgaattacgtgactgattctgccgcctccggcaccgcctgggccact
ggcgtcaaaacctataacggcgccatcggcgtcgatattcatggcaaaccgcacaaaacg
ctcattgaactcgccaaggaaaagggcctcggcaccggcaatgtcagcactgccgaattg
caggatgccacacccgccgtgcaggttgcccatgttacccatcgcaagtgctacgaccca
accagcacggcggaaaagtgcaaggataatgcgcttgaaaatggcggcccaggctcgatc
agcgaacagcttttgaacacccgcccggacgtgacattgggcggcggcgcaaaatatttc
gaggacaaggcccgggctggcacatggaaaggccagaccttgagcgcacaggccgaagca
cgcggctatcaactggttagaaatgccgacgcattgagcaaggtcgagacagccaatcag
gacaaacctgttctcggcctcttctcaccgggcaacatgccggtccgctggaaagggcct
caggccgcccatcacggcaatctcgacagagagcctgtcaagtgcaaggtcaatgagaag
cgcactgccgatattccgacactggcgcaaatgaccgagaaagccatcgacctgctgaaa
accaacgaaaaaggctttttccttcaggtggaaggtgcctccatcgacaaacaggaccat
gccgccaatccgtgcgggcagatcggcgaaacagtcgatctggatgaagccgtgcaggcc
gcactcgattttgcccgcaaagacggcaacacgcttgtcatcgtaacggccgatcacgcc
catgcaagccagatcattgatcccgatgcgaaggctccgggtttgagccaggcattgaaa
accgaggatggcgcgatcatgggcgtgacctatggcaattccgacgaagccgacgatcag
ggccacacaggcgcgcaattgcgcatagccgcctttggccccggcgctgccaattttacc
ggcctcacggatcagacggatatgttctacacgatccgcgatgccttgcagttgcaggcg
gaataa

DBGET integrated database retrieval system