KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_4303Help
Entry
DM39_4303         CDS       T03308                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcen00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DM39_4303
Enzymes [BR:bcen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DM39_4303
Transporters [BR:bcen02000]
 Other Transporters
  Pores ion channels [TC:1]
   DM39_4303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1068992..1069660
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELEVPYEIVRYERDPKTMLAPPALRAIHPLGKSPVVTDDG
RTYAESGAIIEYLVERYGNGRLAPPPGTPERHDYRYWLHYAEGSAMPPLLLKLVALRIAH
ASMPFFARPIARKIAATLQAGFVDPQIALHLGYIDNTLQRSGWFVGDDFSAADIQMSFPL
EAGTARGDAGRHPAIARFLDTIHARPAYRRALERGGPYELLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgtccatcacctgaacaactcgcgctcgcagcgcgtgctctggctgctcgag
gaactggaagtgccgtacgagatcgtccgctacgagcgcgatccgaagacgatgctcgcg
ccgcccgcgctgcgcgcgatccacccgctcggcaagtcgccggtcgtcaccgacgacggc
cgcacctacgccgaatcgggcgcgatcatcgagtatctggtcgagcgctacggcaacggg
cgcctcgcgccgccgcccggcacgcccgagcggcacgactaccggtactggctccattac
gcggaaggctcggcgatgccgccgctgctgctcaagctcgtcgcgctgcggatcgcgcac
gcgtcgatgccgttcttcgcgcggccgatcgcgcgcaagatcgccgcgacgctgcaggcg
ggcttcgtcgatccgcagatcgcgctgcatctcggctacatcgacaacacgctgcagcgc
tcgggctggttcgtcggcgacgacttcagcgcggccgacatccagatgagctttccgctc
gaagccggcaccgcgcgcggcgacgccggccggcatcccgcgatcgcgcgctttctcgac
acgatccatgcgcgcccggcctaccggcgcgcactcgaacgcggcggcccgtacgaactg
ctcaagtga

DBGET integrated database retrieval system