KEGG   Burkholderia cenocepacia H111: I35_4673Help
Entry
I35_4673          CDS       T03804                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bceo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    I35_4673
Enzymes [BR:bceo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     I35_4673
Transporters [BR:bceo02000]
 Other Transporters
  Pores ion channels [TC:1]
   I35_4673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:756548..757210
Genome map
AA seq 220 aa AA seqDB search
MESNARTTLTISSRNYSSWSMRGWLLAKLSGLAFETISVPIDATSRAELLLLSPSILVPC
LTHDGNAVWDTLAIAEYLNEIRPQARLLPDDRHARAHCRSICGEMHSGFSALRSALPMNL
RGHFPGFRIWSRAQHDIERIVTIWRECLAEYGGPWLFGAEIGIADAMYAPVVTRFLTYDV
KLEPDVAEYCMRVLAHPFVAEWIDAAKAEHEDIDELDMEF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaatccaacgcacggacgacgctgaccatcagcagccgcaattactcgtcgtggtcg
atgcgcggctggctgctcgcgaagctgagcgggctcgcgttcgagacgatcagcgtgccg
atcgatgcgacgtcgcgcgcggagctgctgctgctgtcgccgtcgatcctcgtgccgtgc
ctgacgcacgacggcaacgcggtgtgggacacgctcgcgatcgccgaatacctgaacgag
atccgcccgcaggcgcggctgctgcccgacgaccggcatgcgcgcgcgcattgccggtcg
atctgcggcgagatgcattccggcttcagcgcgttgcgatccgcgctgccgatgaacctg
cgcggccatttccccggcttccggatctggtcgcgcgcgcagcacgacatcgagcggatc
gtgacgatctggcgcgagtgcctggccgagtacggtggcccctggctgttcggtgccgag
atcggcatcgccgacgcgatgtatgcgccggtcgtcacgcgcttcctgacctacgacgtg
aaactcgaaccggacgtcgccgagtattgcatgcgcgtcctcgcgcatccgttcgtcgcc
gagtggatcgacgcggcgaaggccgagcacgaagacatcgacgaactcgacatggagttc
tga

DBGET integrated database retrieval system