KEGG   Burkholderia cenocepacia H111: I35_5094Help
Entry
I35_5094          CDS       T03804                                 

Definition
(GenBank) Phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00440  Phosphonate and phosphinate metabolism
bceo01100  Metabolic pathways
bceo01120  Microbial metabolism in diverse environments
bceo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bceo00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    I35_5094
Enzymes [BR:bceo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     I35_5094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: CDN62930
LinkDB All DBs
Position
2:complement(1235171..1236859)
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTESTNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNV
RGAGVDRLKAMLATLQARPDFDTLDIPSLLNELVAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPLSEPGAGNGGAQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcgcgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaatggcctgtccgcgcggatcgtc
cgcgaggccggcttcaaggggatctgggcgtcgggcctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaagcgagctggacccaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgaacagcgcggcatcgccggcgtctgcatcgaggac
aagcagtttccgaagacgaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgaattctgcggcaagatcaaggccggcaaggattcgcagaccgatcccgacttctcg
atcgtcgcgcgtgtcgaagcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtacgcggaagccggcgccgatgcgatcctgatccacagcaagctgtcgcgc
cccgacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcctccgcaatgcaggcgaccgcgcgcgag
atccacgagagcgaaacgctgatcaacgtcgaagaccgcgtcgcatcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcc
tcgcgcgcgtcgaacgcggcgatcgtgctcgccgcgagccgcggcaagggcctggaggcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctcttgcgctgg
ctcgtcgacggcttcaagacgcatggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgccatgcgcagacg
ggcgagctcgcgtcgctcgcgtgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgaccttgcggaaagcgaagccgaa
ttcagcgtcgtggtcgattcgtcgctcaccgagtcgacgaaccagagcgtgcgcgacttc
gccctctgctcggcggccgacgatcgcggcctgttcggccagaagacctacctgcaacgc
gtatcgagcgacgtcgccgcgggcaccccgcacggccgatggatcggcctgctgaacgtg
cgcggcgctggcgtcgaccggctgaaggcgatgctcgcgacactgcaggcgcgccctgat
ttcgacacgctcgacatcccgtcgctgctcaacgagctggtcgccgcgggcgagaagatc
gaggtgcagtacgtgcacggccactggcgcggcgtcaacgacctggaagacttccgccgc
gcgggcgacttcgcgcacggccagacgccgctgtccgagccgggcgccggcaacgggggc
gcgcaatga

DBGET integrated database retrieval system