KEGG   Burkholderia cenocepacia H111: I35_7234Help
Entry
I35_7234          CDS       T03804                                 

Gene name
afcA
Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
Organism
bceo  Burkholderia cenocepacia H111
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3:complement(252689..254389)
Genome map
AA seq 566 aa AA seqDB search
MHRMTFVDDAGHEAGITYRHFAEAVFRQAGALRELGVRENDLVMLALPASVEHAVAMMAC
VMTGALPCTVPVPARRAAAGRQVADVACELYRPRLVIAADAQAAAWRDDAFPAAATRVVD
LATLSSAADVGARALISSKSGRDPHHVQLTSGSTSHPKAAVLSHENVIANVLGIGGSVRF
DIAAGDGTASWLPLYHDMGLLTLLSNLHYRAPLLMMQPNSFIRNPLGWLKRIASARATTT
SVPTFALRYCVRRFNAAAMDGVDLSACRNIFIGGERVDDATLRDFAATFAPYGLAASALQ
PCYGMAESTLAVSMHRAWHEGAVDGAPYVIADTLDRRALIERRDAQPAAANDGQDTETET
VLAMGTPIDGMAFRILDDGDHALANRAVGEVAIRGTSVMLGYLNPDDGTIAAPLTADGWF
RTGDIGYVADGQLHILGRKKEVIIIRGSNYFPHEIEEALASHSALRKSTCIAFGLPDPET
GTERLVVAIEARPVDATPQTRTECQQLLASRIGFAAQDLCFVEPGSLPRTTSGKLQRLKC
RDLYANGALPVIPASAAVEAGQGAFA
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcatgacgttcgtcgacgacgcgggccacgaagcgggcatcacgtaccggcac
ttcgcggaagcggtgtttcgccaggccggcgcgctgcgcgagctcggggtgcgcgagaac
gacctggtgatgcttgcgctgccggcgtcggtcgagcatgcggtcgcgatgatggcgtgc
gtgatgacgggcgcgctcccgtgcaccgtgcccgttcccgcgcggcgtgccgcggccggg
cggcaggtggcggacgtcgcgtgcgagttgtaccggccgcgcctcgtcatcgccgccgac
gcgcaggccgcggcctggcgcgacgacgcgtttcccgcggccgccacgcgcgtcgtcgat
ctcgcgacgctgtcgagcgcggcggacgtcggcgcgcgcgcactgatcagttcgaagagc
ggccgcgatccgcatcatgtgcagctcacgtcgggttcgacgtcgcatccgaaagccgcg
gtgctcagtcacgagaacgtgatcgcgaacgtgctcggcatcggcgggtcggtgcgcttc
gacatcgcggccggcgacggcaccgcgtcgtggctgccgctctatcacgacatggggctg
ctcacgctgctgtcgaacctgcattaccgcgcgccgttgctgatgatgcagccgaacagc
ttcatccggaatccgctcggctggctcaagcgcatcgcgtcggcgcgcgcgacgacgacg
tcggtgccgaccttcgcgctgcgctactgcgtgcgccgcttcaatgccgccgcgatggat
ggcgtcgacctgtccgcgtgccgcaacatcttcatcggcggcgaacgcgtcgacgacgcg
acgctgcgcgatttcgccgcgacgttcgcgccgtacggcctcgcggcgtcggcgctgcaa
ccgtgctacgggatggccgaatcgacgctcgcggtatcgatgcatcgtgcttggcacgaa
ggcgcggtcgacggcgcgccgtacgtgatcgccgatacgctcgaccggcgcgcgctgatc
gagcgccgcgacgcgcagccggccgccgcgaacgatggccaggacacggagaccgaaacg
gtgctcgcgatgggcacgccgatcgacgggatggcgttccgcatcctcgacgacggcgac
cacgcgctggccaatcgcgcggtcggcgaagtcgcgatccgcggcacgtcggtgatgctc
ggctacctgaaccccgacgacggcacgatcgccgcgccgctgacggccgacggctggttc
cgcaccggcgacatcggctacgtcgcggacggccagttgcatatcctcggccgcaaaaag
gaagtcatcatcattcgcggcagcaactatttcccgcacgagatcgaggaagcgttggcc
tcgcacagcgcgctgcgcaagagcacctgcatcgcgttcggcctgcccgatcccgaaacc
ggcaccgagcggctggtcgtcgcgatcgaggcgcggccggtcgacgcgacgccgcaaacg
cgcaccgagtgccagcaactgctcgcgtcgcgcatcggcttcgccgcgcaggatctgtgt
ttcgtcgagcccggctcgctgccgcgcacgacgagcggcaagctgcagcgcctgaagtgc
cgcgatctctatgcgaacggcgcgttgccggtgatcccggcatcggccgccgtcgaagcg
ggccagggagcgttcgcatga

DBGET integrated database retrieval system