KEGG   Burkholderia cepacia ATCC 25416: APZ15_34380Help
Entry
APZ15_34380       CDS       T04772                                 

Definition
(GenBank) AMP-binding protein
Organism
bcep  Burkholderia cepacia ATCC 25416
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:complement(460049..461812)
Genome map
AA seq 587 aa AA seqDB search
MTKCASTIHRLIESLEDVAGATHRMTFVDEAGNEAGITYRRFAEEVFHQAGALRELDVRE
NDLVMLALPASVEHAVAMMACVMTGALPCTVPVPARRATAGRQVIDVACELYRPRLVIAA
DAQAAAWRDDAFPAASTRVVDLDTLSIAADAGARALISAKSGHDPHHVQLTSGSTSHPKA
AVLSHENVIANVLGIGGSVRFDIAAGDGTASWLPLYHDMGLLTLLSNLHYRAPLLMMQPN
SFIRNPLGWLKRIASARATTTSVPTFALRYCVRRFNAAAMEGVDLSACRNIFIGGERVDD
ATLRDFAATFAPYGLAASALQPCYGMAESTLAVSMHRAWHEGTVDGAPYVIADTLDRRAL
IERRDAQPAAANDGADTETETVLAMGTPIDGMAFRILDDGDHALANRAVGEVAIRGTSVM
LGYLNPDDGSIAAPLTADGWFRTGDIGYVSDGQLHILGRKKEVIIIRGSNYFPHDIEEAL
ASHRTLRKSTCIAFGLPDPETGTERLVVAIEARPADATPQTRAECQQLLASRIGFAAQEL
CFVEPGSLPRTTSGKLQRLKCRDLYANGALPVIHAAAAVEAGQGAYA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaagtgcgcatccaccattcatcgcctgatcgaatcgctcgaggacgtcgcgggc
gccacgcatcgcatgacgttcgtcgacgaggccggcaacgaggcaggcatcacgtaccgg
cgcttcgcggaagaagtgtttcaccaggccggcgcgctgcgtgaactcgacgtgcgcgag
aacgacctggtgatgctcgccttgcccgcatcggtcgagcacgcggtcgcgatgatggcc
tgcgtgatgacgggcgcgctgccctgcaccgtgcccgttcccgcgcgccgcgccaccgcc
ggcaggcaagtgatcgacgtcgcgtgcgagctgtatcggccgcgcctcgtcattgccgcc
gatgcgcaggccgccgcgtggcgcgacgacgcgtttcccgcggcatcgacgcgcgtggtc
gatctcgacacgctgtcgatcgccgcggatgccggcgcgcgcgcactgatcagcgcgaag
agcggccatgacccacatcacgtgcagctcacgtcgggctcgacgtcgcacccgaaagcc
gcggtgctcagccacgagaacgtgatcgcgaacgtgctcggcatcggcgggtcggtccgc
ttcgacatcgcggccggtgacggcaccgcctcgtggctgccgctctatcacgacatgggg
ctgctcacgctgctgtcgaacctgcactaccgcgcgccgctgctgatgatgcagccgaac
agcttcatccggaatccgctcggctggctgaagcgcatcgcgtcggcgcgcgcgacgacg
acgtcggtgccgaccttcgcgctgcgctactgcgtgcgccgcttcaacgccgccgcgatg
gaaggcgtcgacctgtccgcgtgccgcaacatcttcatcggcggcgaacgcgtggacgac
gcgacgctgcgcgacttcgccgcgacgttcgcgccgtacggcctcgcggcatcggcgctg
cagccgtgctacgggatggccgaatcgacgctcgcggtgtcgatgcatcgtgcgtggcat
gaaggcacggtggacggcgcaccgtacgtgatcgccgacacgctcgaccggcgtgcgctg
atcgagcggcgcgacgcgcaaccggccgccgcgaacgacggcgccgacaccgagaccgaa
accgtgctcgcgatgggcacgccgatcgacggcatggcctttcgcatcctcgacgacggc
gaccacgcgctcgcgaaccgcgccgtcggcgaagtcgcgattcgcggcacgtcggtgatg
ctcggctacctgaatcccgacgacggctcgatcgccgcgccgctgacggccgacggctgg
ttccgcaccggcgacatcggctacgtctcggacggtcagctccatatcctcgggcgcaag
aaggaagtcatcatcatccgcggcagcaactacttcccgcacgacatcgaggaagcgctg
gcatcgcatcgcacgctgcgcaagagcacgtgcatcgcgttcgggctgcccgaccccgag
acgggcaccgagcggctggtcgtcgcgatcgaggcgcggcccgccgatgcgacgccgcag
acgcgtgccgagtgccagcagctgctcgcgtcgcgcatcggcttcgccgcgcaggagctg
tgcttcgtcgagcccggctcgttgccgcgcaccacgagcggcaagctgcagcgcctgaaa
tgccgcgacctctatgcgaacggcgcgctgcctgtcatccacgcagcggcggcggtcgaa
gccggccagggagcgtacgcatga

DBGET integrated database retrieval system