KEGG   Bacillus cereus G9842: BCG9842_B0845Help
Entry
BCG9842_B0845     CDS       T00815                                 

Gene name
sodA1
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bcg  Bacillus cereus G9842
Brite
Enzymes [BR:bcg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BCG9842_B0845 (sodA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACK95110
UniProt: B7IYC6
LinkDB All DBs
Position
complement(4229784..4230395)
Genome map
AA seq 203 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA
NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEF
AKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRP
DYIGAFWNVVDWNAAEKRYQEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacacgaattaccaaatttaccttatgcgtatgatgctttagagcctcacttt
gacaaagaaacaatgaacatccatcatacaaaacatcacaatacgtatattacaaactta
aacgctgctttagaaggtcatgcagaattagctgacaaaagcgtagaagaattagttgca
aacttaaacgaagtaccagaagcgatccgtacagcagtacgtaacaatggtggcggacac
gctaaccatacattcttctggacaatcttatctccaaacggcggaggacaacctgtaggt
gaacttgcaactgcaattgaagcgaaattcggtagcttcgatgcattcaaagaagaattc
gcaaaagctggcgcaactcgcttcggttctggttgggcttggttagtagtaaacaatggt
gagttagaagtaacaagcactccaaaccaagattctcctttaactgaaggtaaaactcca
gttatcggtttagatgtttgggagcacgcttactacttaaactaccaaaaccgtcgtcca
gactacatcggcgcattttggaacgttgtagattggaacgctgctgaaaaacgttaccaa
gaagcaaaataa

DBGET integrated database retrieval system