KEGG   Bacillus cereus G9842: BCG9842_B4700Help
Entry
BCG9842_B4700     CDS       T00815                                 

Definition
(GenBank) neutral protease Npr599
  KO
K01400  
bacillolysin [EC:3.4.24.28]
Organism
bcg  Bacillus cereus G9842
Brite
Enzymes [BR:bcg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BCG9842_B4700
Peptidases [BR:bcg01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BCG9842_B4700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
591229..592929
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTGATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKYNKLDHVANEDKSPVKQEAPK
QDAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRSTL
PGTLWADADNVFNAAYDAAAVDAHYYAGRTYDYYKATFNRNSINDAGAPLKSTVHYGSKY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSDLIYQNESGALNEAISD
IFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPAKYGDPDHYSKRYTGSSDNGGV
HTNSGIINKQAYLLANGGTHSGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGASSAEVNAVKQSFSAVGVN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcatttgcggattctaaaaatgtactctctacgaagaagtacaatgag
acagtacagtcacctgagtttatttctggtgatttaactggagcgactggtaagaaagca
gaatctgttgtgtttgattacttaaacgcagcaaaaggtgattacaagctaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagtgaagaaagatgctgtaactgattcaaca
gtagtacgtatgcaacaagtttacgaaggagtacctgtatggggttctactcaagtagct
cacgtaagtaaagacggttctttaaaagtattgtctggaacagttgcacctgatttagac
aagaaggaaaagttgaaaaataaaaataagattgaaggcgcaaaagcgattgaaatcgcg
cagcaagacttaggggtaacaccgaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaatggtgaagaaacaacatatgcatacgttgtaaatctaaacttcttagatcct
agtccaggaaactactactatttcattgaagcagacagcggtaaagtattaaataaatat
aataaattggatcatgtagcaaatgaagataagtcaccagttaagcaagaggctcctaaa
caggatgcgaaagcagtagtaaaacctgtaacaggaacaaataaagtaggaactggtaaa
ggtgtattaggagatacgaaatcacttaatacaacattatctggttcatcttactactta
caagataatacgcgcggagcaacgattttcacatacgatgcgaaaaaccgctcaacatta
ccaggaacattatgggcagatgcagataatgttttcaatgcagcgtatgatgcagcggca
gtagatgctcattactatgcaggtagaacatatgattattataaagctacatttaacaga
aactctattaatgatgcaggagcaccattaaaatcaacagttcattacggaagtaagtat
aataatgcattctggaacggttcacaaatggtatacggggatggtgatggtgtaacattc
acttcattatctggtggaattgacgtaattggtcacgaattaacgcatgctgttacggaa
aatagctcggacttaatttatcaaaatgaatcaggggcgttaaatgaagcgatttctgat
atctttggtactttagtagaattctatgataaccgtaacccagattgggagattggtgaa
gatatttacacgcctggtaaagcaggagacgcgcttcgctctatgagtgatccagcgaaa
tatggtgacccagaccactattctaagcgttacacaggttcaagtgataacggtggcgtt
catacaaacagtggtattattaacaaacaagcttatttattagcaaatggtggtacgcat
tctggtgtaactgtaactggtattggtaaagataaattaggtgcgatttactaccgtgca
aatacacagtatttcacgcaatctactacatttagtcaagctcgtgctggtgcagtacaa
gctgctgcggatttatatggtgctagctctgcagaagtaaatgcagtgaagcaatcattt
agtgctgttggtgtaaattaa

DBGET integrated database retrieval system