KEGG   Burkholderia cenocepacia HI2424: Bcen2424_3732Help
Entry
Bcen2424_3732     CDS       T00415                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcen2424_3732
Enzymes [BR:bch01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bcen2424_3732
Transporters [BR:bch02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcen2424_3732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
2:584287..585006
Genome map
AA seq 239 aa AA seqDB search
MRRVRLRCRGTNDIQQGSNMESNARTTLTISSRNYSSWSMRGWLLAKLSGLTFETISVPI
DATSRAELLLLSPSILVPCLTHDGNAVWDTLAIAEYLNEIRPQARLLPEDRHARAHCRSI
CGEMHSGFSALRSALPMNLRGHFPGFRIWSRAQHDIERIVTIWRECLAEYGGPWLFGAEI
GIADAMYAPVVTRFLTYDVKLEPDVAEYCMRVLAHPFVAEWIEEAKAEHEDIDELDMEF
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgtccgtttacggtgcaggggcacgaacgacattcagcaggggagcaacatg
gaatccaacgcacggacgacgctgaccatcagcagccgcaattattcgtcgtggtcgatg
cgcggctggttgctcgcgaagctgagcgggctcacgttcgagacgatcagcgtgccgatc
gatgcgacgtcgcgcgcggagctgctgctgctgtcgccgtcgattctcgtgccgtgcctg
acgcacgacggcaacgcggtgtgggacacgctcgcgatcgccgaatacctgaacgagatc
cgcccgcaggcgcggctgctgcccgaagaccggcatgcacgcgcgcattgccggtcgatc
tgcggcgagatgcattccggcttcagcgcgttgcgatccgcgctgccgatgaacctgcgc
gggcatttccccggcttccggatctggtcgcgcgcgcagcacgacatcgagcggatcgtg
acgatctggcgcgagtgcctggccgagtacggcggcccctggctgttcggtgcggagatc
ggcatcgccgacgcgatgtatgcgccggtcgtcacgcgctttctcacctacgacgtgaag
ctcgaaccggacgttgccgagtactgcatgcgcgttctcgcgcatccgttcgtcgccgag
tggatcgaggaggcgaaggccgagcacgaagacatcgacgagctcgacatggagttctga

DBGET integrated database retrieval system