KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6002Help
Entry
Bcen2424_6002     CDS       T00415                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
3:148989..150791
Genome map
AA seq 600 aa AA seqDB search
MARAAVFLKGRILVTKYASTIHRLIESLEDVAGAMHRMTFVDDAGHEAGITYRHFAEEVF
RQAGALRELGVRENDLVMLALPASVEHAAAMMACVMTGALPCTVPVPMRRAAAGRQVADV
ACELYRPRLVVAADAQAAAWRDDAFPAAATRVVDLATLSSAADAGARALISSKSGRDPHH
VQLTSGSTSHPKAAVLSHENVIANVLGIGGSVRFDIAAGDGTASWLPLYHDMGLLTLLSN
LHYRAPLLMMQPNSFIRNPLGWLKRIASARATTTSVPTFALRYCVRRFNAAAMDGVDLSA
CRNIFIGGERVDDATLRDFAATFAPYGLAASALQPCYGMAESTLAVSMHRAWHEGAVDGA
PYVIADTLDRRALIERRDAQPAAANDGQDTETETVLAMGTPIDGMAFRILDDGGHALANR
AVGEVAIRGTSVMLGYLNPDDGTIAAPLTADGWFRTGDIGYVADGQLHILGRKKEVIIIR
GSNYFPHEIEEALASHSALRKSTCIAFGLPDPETGTERLVVAIEARPVDATPQTRTECQQ
LLASRIGFAAQDLCFVEPGSLPRTTSGKLQRLKCRDLYANGALPVIPASAAVEAVQGAFA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgagcggccgtgttcctcaaggggagaatcctcgtgacgaagtacgcatccacc
attcaccgcctgatcgaatcgctcgaggacgtggcgggcgccatgcatcgcatgacgttc
gtcgacgacgcgggccacgaagcgggcatcacgtaccggcacttcgcggaagaggttttt
cgtcaggccggcgcgctgcgcgagctcggggtacgcgagaacgatctggtgatgctcgcg
ctgccggcgtcggtcgagcatgcagccgcgatgatggcctgcgtgatgaccggtgcactg
ccctgcaccgtgcccgttcccatgcggcgtgcggcggccgggcgacaggtcgcggacgtc
gcgtgcgagctgtaccggccgcgcctggtggttgccgcggacgcgcaagccgcggcctgg
cgcgacgatgcgtttcccgcggccgccacgcgcgtggtcgatctcgcgacgctgtcgagc
gcggcggacgccggcgcgcgcgcactgatcagttccaagagcggccgcgatccgcatcat
gtgcagctcacgtccggttcgacgtcgcatccgaaggccgcggtgctcagccacgagaac
gtgatcgcgaacgtgctcggcatcggcggatcggtgcgattcgacatcgcggccggcgac
ggcaccgcgtcgtggctgccgctctatcacgacatggggctgctcacgctgctgtcaaac
ctgcattaccgcgcgccgctgctgatgatgcagccgaacagcttcatccggaatccgctc
ggctggctgaagcgcatcgcgtcggcgcgcgcgacgacgacgtcggtgccgaccttcgcg
ctgcgctactgcgtgcgccgcttcaacgccgccgcgatggacggcgtcgatctgtccgcg
tgccgcaacatcttcatcggcggcgaacgcgtggacgacgcgacgctgcgcgatttcgcc
gcgacgttcgcgccgtacgggctggcagcgtcggcgctgcagccgtgctacgggatggcc
gaatcgacgctcgcggtatcgatgcatcgtgcatggcacgaaggcgcggtcgacggcgcg
ccgtacgtgatcgccgatacgctcgaccggcgcgcgctgatcgagcgccgcgacgcgcag
ccggccgccgcgaacgacggccaggacacggagaccgaaacggtgctcgcgatgggcacg
ccgatcgacgggatggcgttccgcatcctcgacgacggcggccatgcgctcgccaaccgc
gcggtcggcgaagtcgcgatccgcggcacgtcggtgatgctcggctacctgaaccccgac
gacggcacgatcgccgcgccgctgacggccgacggctggttccgcaccggcgacatcggc
tacgtcgcggacggccagttgcatatcctcggccgcaagaaggaagtcatcatcatccgc
ggcagcaactatttcccgcacgagatcgaggaagcgctggcgtcgcacagcgcgctgcgc
aagagcacctgcatcgcgttcggcctgcccgatcccgaaaccggcaccgagcggctggtc
gtcgcgatcgaggcgcggcccgtcgacgcgacgccgcaaacgcgcaccgagtgccagcag
ttgctcgcgtcgcgcatcggcttcgccgcgcaggatctgtgtttcgtcgagcccggctcg
ctgccgcgcacgacgagcggcaagctgcagcgcctgaagtgtcgcgatctctatgcgaac
ggcgcgctgcccgtgattcccgcgtcggccgccgtcgaagcagtccagggagcgttcgca
tga

DBGET integrated database retrieval system