KEGG   Burkholderia cenocepacia J2315: BCAL0219Help
Entry
BCAL0219          CDS       T00771                                 

Gene name
tufA1
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bcj  Burkholderia cenocepacia J2315
Brite
Translation factors [BR:bcj03012]
 Eukaryotic Type
  Elongation factors
   BCAL0219 (tufA1)
 Prokaryotic Type
   BCAL0219 (tufA1)
Mitochondrial biogenesis [BR:bcj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BCAL0219 (tufA1)
Exosome [BR:bcj04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BCAL0219 (tufA1)
  Exosomal proteins of breast cancer cells
   BCAL0219 (tufA1)
  Exosomal proteins of colorectal cancer cells
   BCAL0219 (tufA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:254043..255233
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVKGSAKLALE
GDTGELGEVAIMSLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagtttgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcacgacggttctgacgaagaagttc
ggcggcgaagcgaaggcgtacgaccagatcgacgcggcaccggaagaaaaggcgcgcggc
atcacgatcaacacggcacacgtcgagtacgaaacggctaaccgccactacgcacacgtc
gactgcccgggccacgctgactatgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgatcctggtttgctcggcagcagacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgaactgctgtcgaag
tacgacttcccgggcgacgacacgccgatcgtgaagggttcggcgaagctggcgctggaa
ggcgacacgggcgagctgggcgaagtggcgatcatgagcctggccgacgcgctggacacg
tacatcccgacgccggagcgtgcagttgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgtggtacggtggtgacgggtcgtgtcgagcgcggcatcgtgaag
gtcggcgaggaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggaccaaggtcaggcaggcgacaacgtgggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgtggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgctccgatcgcgatggaagaaggtctgcgcttcgcaatccgc
gaaggcggccgtacggtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system