KEGG   Burkholderia cenocepacia J2315: BCAS0222Help
Entry
BCAS0222          CDS       T00771                                 

Gene name
afcA
Definition
(GenBank) putative AMP-dependent synthetase
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:complement(238980..240743)
Genome map
AA seq 587 aa AA seqDB search
MTKCASTIHRLIESLEDVAGAMHRMTFVDDAGHEAGITYRHFAEAVFRQAGALRELGVRE
NDLVMLALPASVEHAVAMMACVMTGALPCTVPVPARRAAAGRQVADVACELYRPRLVIAA
DAQAAAWRDDAFPAAATRVVDLATLSSAADAGARALISSKSGRDPHHVQLTSGSTSHPKA
AVLSHENVIANVLGIGGSVRFDIAAGDGTASWLPLYHDMGLLTLLSNLHYRAPLLMMQPN
SFIRNPLGWLKRIASARATTTSVPTFALRYCVRRFNAAAMDGVDLSACRNIFIGGERVDD
ATLRDFAATFAPYGLAASALQPCYGMAESTLAVSMHRAWHEGAVDGAPYVIADTLDRRAL
IERRDAQPAAANDGQDTETETVLAMGTPIDGMAFRILDDGDHALANRAVGEVAIRGTSVM
LGYLNPDDGTIAAPLTADGWFRTGDIGYVADGQLHILGRKKEVIIIRGSNYFPHEIEEAL
ASHSALRKSTCIAFGLPDPETGTERLVVAIEARPVDATPQTRTECQQLLASRIGFAAQDL
CFVEPGSLPRTTSGKLQRLKCRDLYANGALPVIPASAAVEAGQGAFA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaagtgcgcttccaccattcaccgtctgatcgaatcgctcgaggacgtcgcgggc
gccatgcatcgcatgacgttcgtcgacgacgcgggccacgaagcgggcatcacgtaccgg
cacttcgcggaagcggtgtttcgccaggccggcgcgctgcgcgagctcggggtgcgcgag
aacgacctggtgatgcttgcgctgccggcgtcggtcgagcatgcggtcgcgatgatggcg
tgcgtgatgacgggcgcgctgccgtgcaccgtgcccgttcccgcgcggcgtgccgcggcc
gggcggcaggtggcggacgtcgcgtgcgagctgtaccggccgcgcctcgtcatcgccgcc
gacgcgcaggccgcggcctggcgcgacgacgcgtttcccgcggccgccacgcgcgtcgtc
gatctcgcgacgctgtcgagcgcggcggatgccggcgcgcgcgcactgatcagttcgaag
agcggccgcgatccgcatcatgtgcagctcacgtcgggttcgacgtcgcatccgaaagcc
gcggtgctcagtcacgagaacgtgatcgcgaacgtgctcggcatcggcgggtcggtgcgc
ttcgacatcgcggccggcgacggcaccgcgtcgtggctgccgctctatcacgacatgggg
ctgctcacgctgctgtcgaacctgcattaccgcgcgccgttgctgatgatgcagccgaac
agcttcatccgaaatccgctcggctggctcaagcgcatcgcgtcggcgcgcgcgacgacg
acgtcggtgccgaccttcgcgctgcgctactgcgtgcgccgcttcaatgccgccgcgatg
gatggcgtcgacctgtccgcgtgccgcaacatcttcatcggcggcgaacgcgtcgacgac
gcgacgctgcgcgatttcgccgcgacgttcgcgccgtacggcctcgcggcgtcggcgctg
caaccgtgctacgggatggccgaatcgacgctcgcggtatcgatgcatcgtgcttggcac
gaaggcgcggtcgacggcgcgccgtacgtgatcgccgatacgctcgaccggcgcgcgctg
atcgagcgccgcgacgcgcagccggccgccgcgaacgatggccaggacacggagaccgaa
acggtgctcgcgatgggcacgccgatcgacgggatggcgttccgcatcctcgacgacggc
gaccacgcgctggccaatcgcgcggtcggcgaagtcgcgatccgcggcacgtcggtgatg
ctcggctacctgaaccccgacgacggcacgatcgccgcgccgctgacggccgacggctgg
ttccgcaccggcgacatcggctacgtcgcggacggccagttgcatatcctcggccgcaag
aaggaagtcatcatcattcgcggcagcaactatttcccgcacgagatcgaggaagcgttg
gcctcgcacagcgcgctgcgcaagagcacctgcatcgcgttcggcctgcccgatcccgaa
accggcaccgagcggctggtcgtcgcgatcgaggcgcggccggtcgacgcgacgccgcaa
acgcgcaccgagtgccagcaactgctcgcgtcgcgcatcggcttcgccgcgcaggatctg
tgtttcgtcgagcccggctcgctgccgcgcacgacgagcggcaagctgcagcgcctgaag
tgccgcgatctctatgcgaacggcgcgttgccggtgatcccggcatcggccgccgtcgaa
gcgggccagggagcgttcgcatga

DBGET integrated database retrieval system